powered by:
Protein Alignment CG42716 and CG42780
DIOPT Version :9
Sequence 1: | NP_001189116.1 |
Gene: | CG42716 / 10178784 |
FlyBaseID: | FBgn0261633 |
Length: | 97 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001284979.1 |
Gene: | CG42780 / 10178796 |
FlyBaseID: | FBgn0261848 |
Length: | 254 |
Species: | Drosophila melanogaster |
Alignment Length: | 66 |
Identity: | 14/66 - (21%) |
Similarity: | 27/66 - (40%) |
Gaps: | 11/66 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 LAFFTLNMAFANSQLR------CRARMNSGGPR--SCSGSRNIGTAFGLGCAMNFMPLVWYYNDK 63
::.||.|:...:..|. ||..:.:.|.. :| :|:..:||..|..:...:.....||
Fly 1 MSVFTFNIFVLSLVLHSLAENFCRQDLCTKGTTHIAC---QNVNGSFGSSCPKDATVIKLNLGDK 62
Fly 64 S 64
:
Fly 63 N 63
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42716 | NP_001189116.1 |
KU |
<58..92 |
CDD:197529 |
2/7 (29%) |
CG42780 | NP_001284979.1 |
SCP_euk |
62..219 |
CDD:240180 |
1/2 (50%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.