powered by:
Protein Alignment CG42716 and R3hdml
DIOPT Version :9
Sequence 1: | NP_001189116.1 |
Gene: | CG42716 / 10178784 |
FlyBaseID: | FBgn0261633 |
Length: | 97 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001092801.1 |
Gene: | R3hdml / 100043899 |
MGIID: | 3650937 |
Length: | 253 |
Species: | Mus musculus |
Alignment Length: | 53 |
Identity: | 12/53 - (22%) |
Similarity: | 18/53 - (33%) |
Gaps: | 22/53 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 PRSCSGSRNIGTAFGLGCAMNFMPLVWYYNDKSRRCETMPYLGCGGNSNRFCS 84
|..|||. ...::..:||..:.: |||..|: ||
Mouse 158 PWLCSGP----------VCSHYTQMVWASSSR---------LGCAINT---CS 188
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42716 | NP_001189116.1 |
KU |
<58..92 |
CDD:197529 |
7/27 (26%) |
R3hdml | NP_001092801.1 |
CAP_R3HDML |
63..208 |
CDD:349409 |
12/53 (23%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.