DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42716 and col28a2b

DIOPT Version :10

Sequence 1:NP_001189116.1 Gene:CG42716 / 10178784 FlyBaseID:FBgn0261633 Length:97 Species:Drosophila melanogaster
Sequence 2:XP_073809664.1 Gene:col28a2b / 100002791 ZFINID:ZDB-GENE-130530-762 Length:1195 Species:Danio rerio


Alignment Length:36 Identity:15/36 - (41%)
Similarity:22/36 - (61%) Gaps:0/36 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 WYYNDKSRRCETMPYLGCGGNSNRFCSLQDCRFTCL 93
            |||..::..|....|.||.||.|||.:.::|:.||:
Zfish  1158 WYYVPQANACAQFWYGGCEGNRNRFDTEEECKKTCV 1193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42716NP_001189116.1 Kunitz-type <58..92 CDD:438633 13/33 (39%)
col28a2bXP_073809664.1 None

Return to query results.
Submit another query.