DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNIH1 and cni

DIOPT Version :9

Sequence 1:NP_005767.1 Gene:CNIH1 / 10175 HGNCID:19431 Length:144 Species:Homo sapiens
Sequence 2:NP_001260495.1 Gene:cni / 34967 FlyBaseID:FBgn0000339 Length:144 Species:Drosophila melanogaster


Alignment Length:144 Identity:96/144 - (66%)
Similarity:119/144 - (82%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPLVLPEYLIHAFFCVM 65
            |||.|.||.|::||:..|.||||||:|:||||||||||||||||||:||||||||||:|.|..::
  Fly     1 MAFNFTAFTYIVALIGDAFLIFFAIFHVIAFDELKTDYKNPIDQCNSLNPLVLPEYLLHIFLNLL 65

Human    66 FLCAAEWLTLGLNMPLLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKEGWCKLAFYLLAF 130
            ||...||.:|.:|:||:|||||||.:||||||||||||||::..|.|....:|||.|||.||::|
  Fly    66 FLFCGEWFSLCINIPLIAYHIWRYKNRPVMSGPGLYDPTTVLKTDTLYRNMREGWIKLAVYLISF 130

Human   131 FYYLYGMIYVLVSS 144
            |||:|||:|.|:|:
  Fly   131 FYYIYGMVYSLIST 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNIH1NP_005767.1 Cornichon 7..135 CDD:397410 86/127 (68%)
cniNP_001260495.1 Cornichon 7..135 CDD:281325 86/127 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149941
Domainoid 1 1.000 196 1.000 Domainoid score I3119
eggNOG 1 0.900 - - E1_KOG2729
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4219
Inparanoid 1 1.050 216 1.000 Inparanoid score I3613
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52399
OrthoDB 1 1.010 - - D1602458at2759
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 1 1.000 - - otm41570
orthoMCL 1 0.900 - - OOG6_101313
Panther 1 1.100 - - LDO PTHR12290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2906
SonicParanoid 1 1.000 - - X297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.