DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DHRS9 and Adhr

DIOPT Version :9

Sequence 1:NP_001276692.1 Gene:DHRS9 / 10170 HGNCID:16888 Length:379 Species:Homo sapiens
Sequence 2:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster


Alignment Length:243 Identity:57/243 - (23%)
Similarity:94/243 - (38%) Gaps:82/243 - (33%)


- Green bases have known domain annotations that are detailed below.


Human   109 FDKKGFHV--IAACLTESGSTALKAETSERLRT-------VLLDVTDP------ENVKRTAQ--- 155
            ||..|.||  :|.|    |..||  |||:.|.|       :|....:|      :::|.:.|   
  Fly     2 FDLTGKHVCYVADC----GGIAL--ETSKVLMTKNIAKLAILQSTENPQAIAQLQSIKPSTQIFF 60

Human   156 W----------VKNQVGEKGLWGLINNAGVPGVLAPTDWL-------TLEDYRE---PIEVNLFG 200
            |          :|....|              |:...|::       ||.|...   .|..||.|
  Fly    61 WTYDVTMAREDMKKYFDE--------------VMVQMDYIDVLINGATLCDENNIDATINTNLTG 111

Human   201 LISVTLNMLPLVKKAQ----GRVINVSSV-GGRLAIVGGGYTPSKYAVEGFNDSLRRDM--KAFG 258
            :::....:||.:.:..    |.::||:|| |...:.|...|:.||:.|.||..||...:  ...|
  Fly   112 MMNTVATVLPYMDRKMGGTGGLIVNVTSVIGLDPSPVFCAYSASKFGVIGFTRSLADPLYYSQNG 176

Human   259 VHVSCIEPGLFKTNLADPVKV-IEKKLAIWEQLSPDIKQQYGEGYIEK 305
            |.|..:..|        |.:| ::::|..:        .:||:.:.::
  Fly   177 VAVMAVCCG--------PTRVFVDRELKAF--------LEYGQSFADR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DHRS9NP_001276692.1 type2_17beta_HSD-like_SDR_c 90..366 CDD:187665 57/243 (23%)
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 54/238 (23%)
adh_short 7..195 CDD:278532 51/215 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43313
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.