DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK2 and Cdk5

DIOPT Version :9

Sequence 1:XP_011536034.1 Gene:CDK2 / 1017 HGNCID:1771 Length:346 Species:Homo sapiens
Sequence 2:NP_477080.1 Gene:Cdk5 / 36727 FlyBaseID:FBgn0013762 Length:294 Species:Drosophila melanogaster


Alignment Length:339 Identity:174/339 - (51%)
Similarity:224/339 - (66%) Gaps:54/339 - (15%)


- Green bases have known domain annotations that are detailed below.


Human     1 MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVK 65
            |:.:.|:|||||||||.|:|.||:.|.|:||||::|||.:.|||||:|:|||.|||||.|.|||:
  Fly     1 MQKYDKMEKIGEGTYGTVFKGRNRDTMEIVALKRVRLDEDDEGVPSSALREICLLKELKHKNIVR 65

Human    66 LLDVIHTENKLYLVFEFLHQDLKKFMDASALTG-IPLPLIKSYLFQLLQGLAFCHSHRVLHRDLK 129
            |:||:|::.||.||||...|||||:.|  :|.| |.:.:.:|::.|||:||||||||.|||||||
  Fly    66 LIDVLHSDKKLTLVFEHCDQDLKKYFD--SLNGEIDMAVCRSFMLQLLRGLAFCHSHNVLHRDLK 128

Human   130 PQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFA 194
            |||||||..|.:||||||||||||:||:.|:.||||||||.|::|.|.|.|:|::|:||.|||.|
  Fly   129 PQNLLINKNGELKLADFGLARAFGIPVKCYSAEVVTLWYRPPDVLFGAKLYTTSIDMWSAGCILA 193

Human   195 EMHLVGTQHHARCCGEHRRNGRQSLCPLCSYLEVAASQGWGMTAVSTPYPVTRRALFPGDSEIDQ 259
            |:...|                                               |.||||...:||
  Fly   194 ELADAG-----------------------------------------------RPLFPGSDVLDQ 211

Human   260 LFRIFRTLGTPDEVVWPGVTSMPDY--KPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKR 322
            |.:|||.||||:|..||||:.:.||  .||||  |...:|::||.|:..||.||.::|...||:|
  Fly   212 LMKIFRVLGTPNEDSWPGVSHLSDYVALPSFP--AITSWSQLVPRLNSKGRDLLQKLLICRPNQR 274

Human   323 ISAKAALAHPFFQD 336
            |||:||:.||:|.|
  Fly   275 ISAEAAMQHPYFTD 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK2XP_011536034.1 STKc_CDK2_3 3..334 CDD:270844 171/333 (51%)
Cdk5NP_477080.1 PLN00009 1..288 CDD:177649 173/337 (51%)
STKc_CDK5 3..286 CDD:143344 171/333 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100334
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R185
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.