DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK2 and CG1344

DIOPT Version :9

Sequence 1:XP_011536034.1 Gene:CDK2 / 1017 HGNCID:1771 Length:346 Species:Homo sapiens
Sequence 2:NP_001260711.1 Gene:CG1344 / 35500 FlyBaseID:FBgn0027507 Length:683 Species:Drosophila melanogaster


Alignment Length:100 Identity:23/100 - (23%)
Similarity:42/100 - (42%) Gaps:11/100 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    50 REISLLKELNHPNIVKLLDVIHTENKLYLVFEF---LHQDLKKFMDASALTGIPLPLIKSYLFQL 111
            |.|..|....||.|:|.:.......:.||..|.   |.:.|.:..|.....|: ..::.:.:|.:
  Fly    67 RAIKNLMVYRHPYILKYIATWEKSGRKYLATERVRPLDEVLAQQTDIEVCLGL-RTILCALIFLV 130

Human   112 LQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADF 146
            .:.||       .|.::..|::.:...|:.:||.|
  Fly   131 EKALA-------RHLNINTQSIYVTESGSWRLAGF 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK2XP_011536034.1 STKc_CDK2_3 3..334 CDD:270844 22/99 (22%)
CG1344NP_001260711.1 PKc_like 24..>170 CDD:304357 22/99 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.