DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK2 and Pk34A

DIOPT Version :9

Sequence 1:XP_011536034.1 Gene:CDK2 / 1017 HGNCID:1771 Length:346 Species:Homo sapiens
Sequence 2:NP_609603.1 Gene:Pk34A / 34705 FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster


Alignment Length:343 Identity:101/343 - (29%)
Similarity:150/343 - (43%) Gaps:80/343 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    10 IGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKEL-NHPNIVKLLDVIHTE 73
            ||.|::|.||:|....:.|:||:|      :|...|..:..|..::.:| :|.|||:|  ::|:.
  Fly    50 IGSGSFGRVYQAHVNESEEIVAVK------QTLYNPKLSQGEAEIMGQLKDHNNIVRL--IMHSS 106

Human    74 NKL--------YLVFEFLHQDLKKFMDASALTGIP---LPLIKSYLFQLLQGLAFCHSHRVLHRD 127
            ..|        .||.|::...|..:::.......|   |..::...:|:.:||.:.|...:.|||
  Fly   107 VSLGFPSVDYVLLVMEYMPMTLLDYINYHLTVLQPAERLINVRILSYQMFRGLGYLHLLGISHRD 171

Human   128 LKPQNLLI-NTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGC 191
            :||:|||| |.:..:||:|||.|:.. ||.......:.:..|||||:..|.:.||.||||||.||
  Fly   172 VKPENLLIDNQKMVLKLSDFGSAKLL-VPQEPSISYICSRLYRAPELFAGYELYSCAVDIWSAGC 235

Human   192 IFAEM---------------------HLVGTQHHARC------CGE--HRRNGR----------- 216
            :.||:                     :::||....|.      ||.  |.|..|           
  Fly   236 VLAELLKGYPLFSSHKHDRKQLRLIVNMLGTDGLERAPEILSKCGNSLHPRTTRPSWNYLLNTAV 300

Human   217 -QSLCPL---CSYLEVAASQGWGMTAVSTPYPVTR----RAL-FPGDSEIDQLFRIFRTL--GTP 270
             |.||.|   |...|.||.....|......|...|    .|| .|..:.:..||. |.:|  || 
  Fly   301 PQDLCGLLNSCFIYEAAARISPMMACSHGSYDELRIMDAMALPMPNGNPLPPLFD-FNSLEMGT- 363

Human   271 DEVVWPG-----VTSMPD 283
            |..:|..     ::||.|
  Fly   364 DPKLWVNLLPIHLSSMED 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK2XP_011536034.1 STKc_CDK2_3 3..334 CDD:270844 101/343 (29%)
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 86/292 (29%)
S_TKc 45..328 CDD:214567 85/286 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.