DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK2 and Cdk1

DIOPT Version :9

Sequence 1:XP_011536034.1 Gene:CDK2 / 1017 HGNCID:1771 Length:346 Species:Homo sapiens
Sequence 2:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster


Alignment Length:340 Identity:185/340 - (54%)
Similarity:227/340 - (66%) Gaps:59/340 - (17%)


- Green bases have known domain annotations that are detailed below.


Human     1 MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVK 65
            ||:|:|:|||||||||||||.||:|||::||:|||||:::.|||||||||||||||||.|.|||.
  Fly     1 MEDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVC 65

Human    66 LLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPL------PLIKSYLFQLLQGLAFCHSHRVL 124
            |.||:..||::||:||||..||||:||:     :|:      .|::|||:|:...:.|||..|||
  Fly    66 LEDVLMEENRIYLIFEFLSMDLKKYMDS-----LPVDKHMESELVRSYLYQITSAILFCHRRRVL 125

Human   125 HRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSL 189
            |||||||||||:..|.||:|||||.|:||:|||.||||:|||||||||:|||...||..|||||:
  Fly   126 HRDLKPQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSI 190

Human   190 GCIFAEMHLVGTQHHARCCGEHRRNGRQSLCPLCSYLEVAASQGWGMTAVSTPYPVTRRALFPGD 254
            |||||||                                                .||:.||.||
  Fly   191 GCIFAEM------------------------------------------------ATRKPLFQGD 207

Human   255 SEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDP 319
            ||||||||:||.|.||.|.:||||||:||||.:||.|:....:..:..||.:|..|:.:||.|||
  Fly   208 SEIDQLFRMFRILKTPTEDIWPGVTSLPDYKNTFPCWSTNQLTNQLKNLDANGIDLIQKMLIYDP 272

Human   320 NKRISAKAALAHPFF 334
            ..|||||..|.||:|
  Fly   273 VHRISAKDILEHPYF 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK2XP_011536034.1 STKc_CDK2_3 3..334 CDD:270844 182/336 (54%)
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 182/336 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100334
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R185
SonicParanoid 1 1.000 - - X960
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.