DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YAF2 and RYBP

DIOPT Version :9

Sequence 1:XP_011536030.1 Gene:YAF2 / 10138 HGNCID:17363 Length:238 Species:Homo sapiens
Sequence 2:NP_001286742.1 Gene:RYBP / 37601 FlyBaseID:FBgn0034763 Length:150 Species:Drosophila melanogaster


Alignment Length:216 Identity:74/216 - (34%)
Similarity:91/216 - (42%) Gaps:66/216 - (30%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRMKNHEIISFLKEGE 65
            |..|.||.|.:::.....:|.:|||||||:|||||||||.||||||||||               
  Fly     1 MDKKSSPVRRQKRQAKVIEENFWDCSVCTYRNSAEAFKCRMCDVRKGTST--------------- 50

Human    66 KKKLDHLPVTGVLLLGNLHRSTLFEVIVSASRTKEPLKFPISGRKPRPVSQLVAQQVTQQFVPPT 130
                                                       ||||..|.|||||..   ..|.
  Fly    51 -------------------------------------------RKPRLNSALVAQQAA---TLPG 69

Human   131 QSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDFKEKTKSP 195
            .|......| ....|...:...:..||:...||||||||:||..||||..:||.||::|.|    
  Fly    70 ASVNMPNGK-SASGSRHGSGHDRQRHKRYPARLKNVDRSTAQTREVTVNSVTVFITEYKAK---- 129

Human   196 PASSAASADQHSQSGSSSDNT 216
            |.||...:.:.|.|.|:...:
  Fly   130 PVSSRRESSEQSFSESNDSRS 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YAF2XP_011536030.1 zf-RanBP 20..43 CDD:279035 18/22 (82%)
RanBP2-type Zn finger 23..42 CDD:275376 16/18 (89%)
RYBPNP_001286742.1 zf-RanBP 20..43 CDD:279035 18/22 (82%)
RanBP2-type Zn finger 23..42 CDD:275377 16/18 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141019
Domainoid 1 1.000 51 1.000 Domainoid score I11598
eggNOG 1 0.900 - - E1_KOG4477
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I4714
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49670
OrthoDB 1 1.010 - - D1634090at2759
OrthoFinder 1 1.000 - - FOG0003518
OrthoInspector 1 1.000 - - otm41962
orthoMCL 1 0.900 - - OOG6_108317
Panther 1 1.100 - - O PTHR12920
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5806
SonicParanoid 1 1.000 - - X3403
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.