DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CELA3A and CG11836

DIOPT Version :9

Sequence 1:NP_005738.4 Gene:CELA3A / 10136 HGNCID:15944 Length:270 Species:Homo sapiens
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:261 Identity:73/261 - (27%)
Similarity:117/261 - (44%) Gaps:41/261 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    23 SHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCIS--RDLTYQVVL 85
            |:...|:|.|:......:||...:.|:  |.|:  |||||:..|:|::|.||:.  |....:|:.
  Fly    91 SNEEIRIVGGKPTGVNQYPWMARIVYD--GKFH--CGGSLLTKDYVLSAAHCVKKLRKSKIRVIF 151

Human    86 GEYNLAVKEGPE----QVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLP- 145
            |:::..:....:    .|..:...:.|....:|       |||||::|.:.......::...|| 
  Fly   152 GDHDQEITSESQAIQRAVTAVIKHKSFDPDTYN-------NDIALLRLRKPISFSKIIKPICLPR 209

Human   146 ----PAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAG 206
                |||.|      ..:.||||....|.||..:.|.::|::....|....:..:.:..:|:|||
  Fly   210 YNYDPAGRI------GTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAG 268

Human   207 GYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAF-----GCNFIWKPTVFTRVSAFIDWIEET 266
            ......|.|||||||...        :||..|:...     ||.....|.|::|||.||.||:..
  Fly   269 RPSMDSCQGDSGGPLLLS--------NGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSN 325

Human   267 I 267
            :
  Fly   326 L 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CELA3ANP_005738.4 Tryp_SPc 28..263 CDD:214473 70/250 (28%)
Tryp_SPc 29..266 CDD:238113 71/252 (28%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 71/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5507
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.