DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARL4C and Arf102F

DIOPT Version :9

Sequence 1:NP_001269360.1 Gene:ARL4C / 10123 HGNCID:698 Length:201 Species:Homo sapiens
Sequence 2:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster


Alignment Length:186 Identity:84/186 - (45%)
Similarity:118/186 - (63%) Gaps:10/186 - (5%)


- Green bases have known domain annotations that are detailed below.


Human     1 MG-NISSNISAF---QSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKG 61
            || .|||.::..   :.:.|:|:|||:|||||:||:||..|.|.|:||||||.|.::..|     
  Fly     1 MGLTISSLLTRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN----- 60

Human    62 ISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIA 126
            |....||||||:|:||||:.|.:.|.|:|:||||.|.||:.||:.||..:.:..|.:...|||.|
  Fly    61 ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFA 125

Human   127 NKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKR 182
            ||||||.::..||:..:|.|::| ....:.:|..||..|.||.||:|.|...:.|:
  Fly   126 NKQDLPNAMTAAELTDKLRLNQL-RNRHWFIQSTCATQGHGLYEGLDWLSAELAKK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARL4CNP_001269360.1 Arl4_Arl7 11..192 CDD:206719 79/175 (45%)
Arf102FNP_001259087.1 YlqF_related_GTPase 1..180 CDD:424112 83/184 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.