DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACTR1A and Act79B

DIOPT Version :9

Sequence 1:NP_005727.1 Gene:ACTR1A / 10121 HGNCID:167 Length:376 Species:Homo sapiens
Sequence 2:NP_001262200.1 Gene:Act79B / 40444 FlyBaseID:FBgn0000045 Length:376 Species:Drosophila melanogaster


Alignment Length:370 Identity:197/370 - (53%)
Similarity:280/370 - (75%) Gaps:7/370 - (1%)


- Green bases have known domain annotations that are detailed below.


Human    12 VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPME 76
            :|:|||||:.|||||||..|:..||:.||||:|..||.|..:.|.::|.:|:..||:||::||:|
  Fly     9 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQSKRGILSLKYPIE 73

Human    77 HGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISM 141
            |||:.:|:|||::|.:.: .::|:...||||||||||||||:.|||:..::.|||||.||:::::
  Fly    74 HGIITNWDDMEKVWHHTF-YNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAI 137

Human   142 QAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFH 206
            ||||||||:|||||:||||||||:|.||||||:|:||:|:|:|:||||::.:|...|.:.||.|.
  Fly   138 QAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFT 202

Human   207 SSSEFEIVKAIKERACYLSINPQKD-----ETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPD 266
            :::|.|||:.|||:.||::::.:::     .:...||: |.||||..|.||..|||.||.||:|.
  Fly   203 TTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKS-YELPDGQVITIGNERFRTPEALFQPS 266

Human   267 LIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRIS 331
            .:|.||.||||.:..:|.|.|:|:|:.|::|.|||||:|::.|..||:..|:..|||..:||:|.
  Fly   267 FLGMESCGIHETVYQSIMKCDVDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTIKIKII 331

Human   332 APQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF 376
            ||.||.||.||||||||||.||::||:||:||:|.|...:|||.|
  Fly   332 APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACTR1ANP_005727.1 NBD_sugar-kinase_HSP70_actin 5..376 CDD:418402 196/368 (53%)
Act79BNP_001262200.1 PTZ00281 1..376 CDD:173506 196/368 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 1 1.000 - - FOG0000057
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.