DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACTR1A and Arp6

DIOPT Version :9

Sequence 1:NP_005727.1 Gene:ACTR1A / 10121 HGNCID:167 Length:376 Species:Homo sapiens
Sequence 2:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster


Alignment Length:408 Identity:107/408 - (26%)
Similarity:191/408 - (46%) Gaps:50/408 - (12%)


- Green bases have known domain annotations that are detailed below.


Human     7 IANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71
            :||..||:|||:...|.|.|....| :..||.:.:.|..|..|       |:|.:.:|.|...::
  Fly     1 MANAVVVLDNGAHTAKVGLANQDEP-HVVPNCIMKAKSERRRA-------FVGNQIDECRDTSAL 57

Human    72 RY--PMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNV 134
            .|  ..:.|.:.:|:..:.:|.|::|||.:....|...:::||..:|.:..:|...|:.||.:.|
  Fly    58 YYILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKV 122

Human   135 PALFISMQAVLSLY-----ATGRTT-----GVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRD 189
            ..::.:..|.|:.:     :..|||     .:::|.|...||.||...|..:...|.|||:.|:.
  Fly   123 DGVYKTTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKA 187

Human   190 VSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQK-------DETLETEKAQYYLPDGS 247
            ::..|:..:...  ..:...|..:|..|||..|:::.:.::       :|........|.|||.:
  Fly   188 LTNQLKELISYR--HLNVMDESHVVNQIKEDVCFVAEDFKQAMQVHYSEEKRREVTVDYVLPDFT 250

Human   248 TIEIG---------------------PSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLR 291
            |::.|                     ..||..|||||.|..||.:..||.|.:...::....:..
  Fly   251 TVKRGYVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQQVGIPEAVADCLKACPWEAH 315

Human   292 RTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKM 356
            |.|..||::.|||..|.||..||..:::.|.|.|:::.:..|::.:...|.||..:|:...|::.
  Fly   316 RELLLNILIVGGSAQFPGFLPRLKRDLRALVPDDLEVSLICPEDPVRYAWYGGKEVATSPNFEEF 380

Human   357 WVSKKEYEEDGARSIHRK 374
            ..::.:|||.|.:.|:::
  Fly   381 VYTQDDYEEYGFQGINQR 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACTR1ANP_005727.1 NBD_sugar-kinase_HSP70_actin 5..376 CDD:418402 107/408 (26%)
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 106/404 (26%)
COG5277 6..391 CDD:227602 103/394 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.