DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OPN1MW3 and Rh3

DIOPT Version :9

Sequence 1:NP_001316996.1 Gene:OPN1MW3 / 101060233 HGNCID:51831 Length:364 Species:Homo sapiens
Sequence 2:NP_524411.1 Gene:Rh3 / 42398 FlyBaseID:FBgn0003249 Length:383 Species:Drosophila melanogaster


Alignment Length:352 Identity:83/352 - (23%)
Similarity:141/352 - (40%) Gaps:51/352 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    45 YHIAPRWVYHLTSVWM-----------------IFVVIASVFTNGLVLAATMKFKKLRHPLNWIL 92
            :::.|..:.|:...|:                 ||..:.|:..||||:......|.||.|.|.::
  Fly    33 WNVPPEELRHIPEHWLTYPEPPESMNYLLGTLYIFFTLMSMLGNGLVIWVFSAAKSLRTPSNILV 97

Human    93 VNLAVADLAETVIASTISVVNQVYGYFVLGHPMCVLEGYTVSLCGITGLWSLAIISWERWMVVCK 157
            :|||..|.. .::.:.|.:.|..:..:.|||..|.:.|...|..||....:.|.|:::|:.|:.:
  Fly    98 INLAFCDFM-MMVKTPIFIYNSFHQGYALGHLGCQIFGIIGSYTGIAAGATNAFIAYDRFNVITR 161

Human   158 PFGNVRFDAKLAIVGIAFSWIWAAVW-TAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMI 221
            |........| ||..|.|.:::|..| .|.....|.|:.|.|..|||..|..:       .::..
  Fly   162 PMEGKMTHGK-AIAMIIFIYMYATPWVVACYTETWGRFVPEGYLTSCTFDYLT-------DNFDT 218

Human   222 VLMVTCC-----ITPLSIIVLCYLQV-------WLAIRAVAKQQK-ES------ESTQKAEKEVT 267
            .|.|.|.     :.|.::|...|.|:       ..|:|..||:.. ||      ::.:.||..:.
  Fly   219 RLFVACIFFFSFVCPTTMITYYYSQIVGHVFSHEKALRDQAKKMNVESLRSNVDKNKETAEIRIA 283

Human   268 RMVVVMVLAFCFCWGPYAFFACFAAANPGYPFHPLMAALPAFFAKSATIYNPVIYVFMNRQFR-- 330
            :..:.:...|...|.||...:...|........|....:||...|.....:|.:|...:.::|  
  Fly   284 KAAITICFLFFCSWTPYGVMSLIGAFGDKTLLTPGATMIPACACKMVACIDPFVYAISHPRYRME 348

Human   331 ---NCILQLFGKKVDDGSELSSASKTE 354
               .|......:|..:.|.::|.|.|:
  Fly   349 LQKRCPWLALNEKAPESSAVASTSTTQ 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OPN1MW3NP_001316996.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Required for 11-cis-retinal regeneration. /evidence=ECO:0000250|UniProtKB:P04001 17..43
7tm_4 61..>178 CDD:304433 36/116 (31%)
7tm_1 71..322 CDD:278431 69/270 (26%)
Rh3NP_524411.1 7tm_4 66..>191 CDD:304433 39/126 (31%)
7tm_1 75..338 CDD:278431 69/271 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X120
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.