DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OPN1MW3 and dop-4

DIOPT Version :9

Sequence 1:NP_001316996.1 Gene:OPN1MW3 / 101060233 HGNCID:51831 Length:364 Species:Homo sapiens
Sequence 2:NP_508238.2 Gene:dop-4 / 183715 WormBaseID:WBGene00016872 Length:517 Species:Caenorhabditis elegans


Alignment Length:525 Identity:96/525 - (18%)
Similarity:168/525 - (32%) Gaps:210/525 - (40%)


- Green bases have known domain annotations that are detailed below.


Human    12 GRHP--QDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSVWMIFVVIASVFTNGLV 74
            |..|  :|.|...|.|   ..|.:::|....|.|   .|..|.:.|.::.:..:.:.:|..|.||
 Worm     5 GSDPNAEDLYITMTPS---VSTENDTTVWATEEP---AAIVWRHPLLAIALFSICLLTVAGNCLV 63

Human    75 LAATMKFKKLRHPLNWILVNLAVADLAETVIASTISVVNQVYGY-FVLGHPMCVLEGYTVSLCGI 138
            :.|....|.||:|..:::::||:|||...||...::.:.::..: ::.|..||.:......|...
 Worm    64 VIAVCTKKYLRNPTGYLIISLAIADLIVGVIVMPMNSLFEIANHTWLFGLMMCDVFHAMDILAST 128

Human   139 TGLWSLAIISWERWMVVCKPFG-NVRFDAKLAIVGIAFSWIWAAVWTAPPIFGWSRYWPHGL--K 200
            ..:|:|.:||.:|:|....|.| ..:...:..::.|...|:.:|:.:.|.|..|....||..  :
 Worm   129 ASIWNLCVISLDRYMAGQDPIGYRDKVSKRRILMAILSVWVLSAILSFPGIIWWRTSSPHLYEDQ 193

Human   201 TSCGPDVFSGS----SYPGVQSYMIVLMVTCCITPLSIIVLCYLQVW-----------LAIRAVA 250
            :.|   :|:.|    |:..:.|:.|         ||.:|:..|.:|:           :.|:.|:
 Worm   194 SQC---LFTDSKMYVSFSSLVSFYI---------PLFLILFAYGKVYIIATRHSKGMRMGIKTVS 246

Human   251 -------KQQKESESTQKAEKEVT----------------------------------------- 267
                   |...|:||...:|.|.|                                         
 Worm   247 IKKRNGKKSNTETESILSSENEPTLRIHFGRGKQSSSSLRNSRFHARESTRLLLKQVSCKSLNDR 311

Human   268 ----------------------------------------------------------------- 267
                                                                             
 Worm   312 GEHNNNNTVRQPLLRGTEGCHSDSISRSSQRNFRGRNVTIGSNCSSTLLQVDQPDRMSLSSNSQM 376

Human   268 -------------------------------RMVVVMVLAFCFCWGPYAFFACFAAANPGYPFHP 301
                                           |.:.::|.||..||.|:            :.|.|
 Worm   377 VMTSPLSTRRKLNVREKSRQMMRYVHEQRAARTLSIVVGAFILCWTPF------------FVFTP 429

Human   302 LMAALPAFFAKSATIY-------------NPVIYVFMNRQFRNCILQLFGKKVDDGSELSSASKT 353
            |.|...:.|:...||:             ||:||...:|.||....|:.  ......::.:|.||
 Worm   430 LTAFCESCFSNKETIFTFVTWAGHLNSMLNPLIYSRFSRDFRRAFKQIL--TCQRQQKVKTAFKT 492

Human   354 EVSSV 358
            .:|.|
 Worm   493 PLSLV 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OPN1MW3NP_001316996.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 4/12 (33%)
Required for 11-cis-retinal regeneration. /evidence=ECO:0000250|UniProtKB:P04001 17..43 7/25 (28%)
7tm_4 61..>178 CDD:304433 29/118 (25%)
7tm_1 71..322 CDD:278431 71/426 (17%)
dop-4NP_508238.2 7tm_4 53..>245 CDD:304433 48/203 (24%)
7tm_1 59..463 CDD:278431 71/427 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.