DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OPN1MW3 and frpr-3

DIOPT Version :9

Sequence 1:NP_001316996.1 Gene:OPN1MW3 / 101060233 HGNCID:51831 Length:364 Species:Homo sapiens
Sequence 2:NP_505004.1 Gene:frpr-3 / 182942 WormBaseID:WBGene00016149 Length:360 Species:Caenorhabditis elegans


Alignment Length:249 Identity:50/249 - (20%)
Similarity:103/249 - (41%) Gaps:47/249 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    60 MIFVVIASVFTN--GLVLAATMKFKKLRHPLNWILVNLAVADLA--------------ETVIAST 108
            |:.:....:.||  ...:.....|:|  ..:|.:|..|:::||.              :.||..|
 Worm    13 MVLMCFGGILTNFISFYIYTRKTFRK--KSINVLLAALSMSDLCVCVLAIPVFASTQLQQVIPPT 75

Human   109 ISVVNQVYGYFVLGHPMCVLEGYTVSLCGITGLWSLAIISWERWMVVCKPF-GNVRFDAKLAIVG 172
            |:.:..||.|.|           |:....:: :|.|..|:.:|::.||.|| .|.......|::.
 Worm    76 ITAMIMVYLYPV-----------TIMFQSVS-VWLLVSITIDRYLAVCHPFMVNTYCTRNRALIT 128

Human   173 IAFSWIWAAVWTAPPIFGWSRYWPHGLKTSCGPD--VFSGSSYPGVQS-------YM-IVLMVTC 227
            :....|::..      :...|.|.:.:.....|:  .......|.:::       |. :..:|:.
 Worm   129 VGVVVIFSVA------YNLIRIWEYTINFDVAPENRTIEDLVVPKLRANPHFLLWYQNVATLVSQ 187

Human   228 CITPLSIIVLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVLAFCFCW 281
            ...||:::.:..:||...|...::|::|..::.|.|....:|::::||.|..|:
 Worm   188 FAFPLTVLCVLNIQVARTIIEASEQRRELVASVKREHSTAKMMIMVVLVFLVCY 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OPN1MW3NP_001316996.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Required for 11-cis-retinal regeneration. /evidence=ECO:0000250|UniProtKB:P04001 17..43
7tm_4 61..>178 CDD:304433 28/133 (21%)
7tm_1 71..322 CDD:278431 48/238 (20%)
frpr-3NP_505004.1 7tmA_FMRFamide_R-like 12..294 CDD:320109 50/249 (20%)
TM helix 1 12..34 CDD:320109 3/20 (15%)
TM helix 2 41..66 CDD:320109 5/24 (21%)
TM helix 3 81..111 CDD:320109 9/41 (22%)
TM helix 4 123..143 CDD:320109 2/25 (8%)
TM helix 5 176..201 CDD:320109 4/24 (17%)
TM helix 6 221..251 CDD:320109 7/21 (33%)
TM helix 7 264..289 CDD:320109
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.