| Sequence 1: | NP_001316996.1 | Gene: | OPN1MW3 / 101060233 | HGNCID: | 51831 | Length: | 364 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_510154.3 | Gene: | frpr-2 / 182268 | WormBaseID: | WBGene00007346 | Length: | 353 | Species: | Caenorhabditis elegans |
| Alignment Length: | 197 | Identity: | 38/197 - (19%) |
|---|---|---|---|
| Similarity: | 69/197 - (35%) | Gaps: | 54/197 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Human 57 SVW---MIFVVIASVFTNGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIASTISVVNQVYGY 118
Human 119 FVLGHPMCVLEGYTVSLCGITGLWSLAIISWERWMVVCKPFGNVRFDAKLAIVGIAFSWIWAAVW 183
Human 184 TAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMVTCCITPLSIIVLCYLQVWLAIRA 248
Human 249 VA 250 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| OPN1MW3 | NP_001316996.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..23 | ||
| Required for 11-cis-retinal regeneration. /evidence=ECO:0000250|UniProtKB:P04001 | 17..43 | ||||
| 7tm_4 | 61..>178 | CDD:304433 | 22/116 (19%) | ||
| 7tm_1 | 71..322 | CDD:278431 | 33/180 (18%) | ||
| frpr-2 | NP_510154.3 | 7tmA_FMRFamide_R-like | 29..318 | CDD:320109 | 38/197 (19%) |
| TM helix 1 | 30..53 | CDD:320109 | |||
| TM helix 2 | 60..82 | CDD:320109 | |||
| TM helix 3 | 102..124 | CDD:320109 | |||
| TM helix 4 | 146..162 | CDD:320109 | 3/15 (20%) | ||
| TM helix 5 | 196..219 | CDD:320109 | 9/39 (23%) | ||
| TM helix 6 | 247..272 | CDD:320109 | 6/24 (25%) | ||
| TM helix 7 | 286..311 | CDD:320109 | 1/1 (100%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||