DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OPN1MW3 and dop-5

DIOPT Version :9

Sequence 1:NP_001316996.1 Gene:OPN1MW3 / 101060233 HGNCID:51831 Length:364 Species:Homo sapiens
Sequence 2:NP_505884.1 Gene:dop-5 / 179571 WormBaseID:WBGene00011382 Length:763 Species:Caenorhabditis elegans


Alignment Length:99 Identity:27/99 - (27%)
Similarity:54/99 - (54%) Gaps:7/99 - (7%)


- Green bases have known domain annotations that are detailed below.


Human   247 RAVAKQQKESESTQKAEKEVTRMVVVMVLAFCFCWGPYAFFACFAAANPGY------PFHPLMAA 305
            ||:.::::||.:.:: |...||:|..:::||..||.||...:.|.....|:      |.|..:..
 Worm   655 RAIRRKRRESMAIRR-ESRATRVVAAILIAFLICWIPYFCISIFRGVLMGFQININTPIHLTLFV 718

Human   306 LPAFFAKSATIYNPVIYVFMNRQFRNCILQLFGK 339
            ..::...:.:.:||:||:.:|:.|||.:.::..|
 Worm   719 YTSWLGYAHSCFNPLIYMCLNKNFRNTMRKMMQK 752

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OPN1MW3NP_001316996.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Required for 11-cis-retinal regeneration. /evidence=ECO:0000250|UniProtKB:P04001 17..43
7tm_4 61..>178 CDD:304433
7tm_1 71..322 CDD:278431 20/80 (25%)
dop-5NP_505884.1 7tmA_amine_R-like 38..>207 CDD:320098
TM helix 2 58..80 CDD:320098
TM helix 3 97..119 CDD:320098
TM helix 4 142..158 CDD:320098
TM helix 5 175..198 CDD:320098
7tm_GPCRs <668..746 CDD:391938 22/78 (28%)
TM helix 6 668..698 CDD:341315 10/30 (33%)
TM helix 7 714..739 CDD:341315 4/24 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.