DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OPN1MW3 and ser-4

DIOPT Version :9

Sequence 1:NP_001316996.1 Gene:OPN1MW3 / 101060233 HGNCID:51831 Length:364 Species:Homo sapiens
Sequence 2:NP_497452.1 Gene:ser-4 / 175322 WormBaseID:WBGene00004779 Length:445 Species:Caenorhabditis elegans


Alignment Length:422 Identity:73/422 - (17%)
Similarity:120/422 - (28%) Gaps:192/422 - (45%)


- Green bases have known domain annotations that are detailed below.


Human    55 LTSVWMIFVVIASVFTNGL-VLAATMKFKKLR-HPLNWILVNLAVADLAETVIASTISVVNQVYG 117
            |.||  :.|:|.|.|...| |:.|.:..:.|| .|..:::.:||||||...:|.:.:.      .
 Worm    54 LASV--LLVLILSCFIGNLFVILAIIMERDLRGRPQYYLIFSLAVADLLVGMIVTPLG------A 110

Human   118 YFVLGHPMCVLEGYTVSLCGITGLWSLAIISWERW----MVVCKPFGNVRFDAKLAIVGIAFSWI 178
            :|.                 :||.|:|.::..:.|    ::||..       :.|.:|.||....
 Worm   111 WFT-----------------VTGTWNLGVVVCDFWISVDVLVCTA-------SILHLVAIALDRY 151

Human   179 W--------------------AAVW------TAPPIFGW--SRYWPHGLKTS-CGPDVFSGSSYP 214
            |                    |.:|      :..|..||  ..:....||:. |   :.|...  
 Worm   152 WSITDICYVQNRTPKRITLMLAVIWFTSLLISLAPFAGWKDEGFSDRVLKSHVC---LISQQI-- 211

Human   215 GVQSYMIVLMVTCCITPLSIIVLCYLQVWLAIRAVAKQQK------------------------- 254
               ||.:....|....||..|:..|   |..:||..|:.|                         
 Worm   212 ---SYQVFSTATAFYIPLIAIICVY---WKIMRAAKKRFKRERDRRTVIRPPPDAIDEKKAMMPK 270

Human   255 -------------------------------------------ESEST----------------- 259
                                                       |.|.|                 
 Worm   271 KSKKCPLPPAVVISDIQANGGTGGKTNSIKNPPRHNESSSSASEEERTMTQTNHAPGDVTTQETK 335

Human   260 ------------------------QKAEKEVTRMVVVMVLAFCFCWGPYAFFACFAAANP--GYP 298
                                    .|.|::..|.:.::...|..||.|:...:.:   .|  |..
 Worm   336 IDEENGRSKPGIVKRRRRTKESNEMKRERKAWRTLAIITGTFVACWTPFFLVSIY---RPICGCQ 397

Human   299 FHPLMAALPAFFAKSATIYNPVIYVFMNRQFR 330
            ..|::..:..:.....:..||:||...::.||
 Worm   398 ISPVLEQVTLWLGYLNSALNPIIYTVFSQDFR 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OPN1MW3NP_001316996.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Required for 11-cis-retinal regeneration. /evidence=ECO:0000250|UniProtKB:P04001 17..43
7tm_4 61..>178 CDD:304433 29/122 (24%)
7tm_1 71..322 CDD:278431 62/396 (16%)
ser-4NP_497452.1 7tmA_5-HT1A_invertebrates 52..432 CDD:320454 73/422 (17%)
TM helix 1 53..79 CDD:320454 10/26 (38%)
TM helix 2 87..113 CDD:320454 7/31 (23%)
TM helix 3 125..155 CDD:320454 8/36 (22%)
TM helix 4 166..188 CDD:320454 3/21 (14%)
TM helix 5 210..239 CDD:320454 8/36 (22%)
TM helix 6 361..391 CDD:320454 7/32 (22%)
TM helix 7 400..425 CDD:320454 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.