DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTDSP2 and hzg

DIOPT Version :9

Sequence 1:XP_005268613.1 Gene:CTDSP2 / 10106 HGNCID:17077 Length:277 Species:Homo sapiens
Sequence 2:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster


Alignment Length:314 Identity:155/314 - (49%)
Similarity:190/314 - (60%) Gaps:69/314 - (21%)


- Green bases have known domain annotations that are detailed below.


Human     1 MEHGSIITQARREDALVLTKQGLVSKSSPK-------------------------------KPRG 34
            |:..|||||..|:|     :|..|..|.|.                               ||:.
  Fly     1 MDATSIITQVSRDD-----EQLNVYPSYPNDKDAWLGFSGSVWLPDCPADHAQLTHDVDRLKPQK 60

Human    35 RNIFKALFCCFRAQHVGQSSSSTELAAYKEEANTIAKSDLLQCLQYQFYQVRDSGLIPGTC---- 95
            |.:|.:|.||:|......:.:.|::                           |....|...    
  Fly    61 RGLFHSLLCCWRRNRTKTNQNGTQI---------------------------DGSTTPPPLPDQQ 98

Human    96 --LLPEVTEEDQGRICVVIDLDETLVHSSFKPINNADFIVPIEIEGTTHQVYVLKRPYVDEFLRR 158
              |||:|...|..|.|:||||||||||||||||.|||||||:||:||.|||||||||:|||||::
  Fly    99 RYLLPQVRLTDMHRKCMVIDLDETLVHSSFKPIPNADFIVPVEIDGTVHQVYVLKRPHVDEFLQK 163

Human   159 MGELFECVLFTASLAKYADPVTDLLDRCGVFRARLFRESCVFHQGCYVKDLSRLGRDLRKTLILD 223
            ||||:||||||||||||||||.||||:..||||||||||||:::|.|:|||:||||||:|.:|:|
  Fly   164 MGELYECVLFTASLAKYADPVADLLDKWNVFRARLFRESCVYYRGNYIKDLNRLGRDLQKIVIVD 228

Human   224 NSPASYIFHPENAVPVQSWFDDMADTELLNLIPIFEELSGAEDVYTSLGQLRAP 277
            ||||||||||:|||||:|||||:.|.||..|||:||:||..:.||:.|.....|
  Fly   229 NSPASYIFHPDNAVPVKSWFDDVTDCELRELIPLFEKLSKVDSVYSVLCNSNQP 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTDSP2XP_005268613.1 HIF-SF_euk 107..266 CDD:274055 123/158 (78%)
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 123/157 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158655
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S764
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 1 1.000 - - FOG0000901
OrthoInspector 1 1.000 - - otm41140
orthoMCL 1 0.900 - - OOG6_100959
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1679
SonicParanoid 1 1.000 - - X485
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.590

Return to query results.
Submit another query.