Sequence 1: | XP_005268613.1 | Gene: | CTDSP2 / 10106 | HGNCID: | 17077 | Length: | 277 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_612023.1 | Gene: | ttm2 / 38049 | FlyBaseID: | FBgn0035124 | Length: | 409 | Species: | Drosophila melanogaster |
Alignment Length: | 196 | Identity: | 59/196 - (30%) |
---|---|---|---|
Similarity: | 86/196 - (43%) | Gaps: | 33/196 - (16%) |
- Green bases have known domain annotations that are detailed below.
Human 96 LLPEVTEED--QGRICVVIDLDETLVHSSFKPINNADFIVPIEIEGTTHQV--YVLKRPYVDEFL 156
Human 157 RRMGELFECVLFTASLAKYADPVTDLLDRCGVFRARLFRESCVFHQGCYVKDLSRLGRDLRKTLI 221
Human 222 LDNSPASYIFHPENAVPVQSWFDDMADTELLNLIPIFEELSGAE--DV------YT----SLGQL 274
Human 275 R 275 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CTDSP2 | XP_005268613.1 | HIF-SF_euk | 107..266 | CDD:274055 | 48/162 (30%) |
ttm2 | NP_612023.1 | CPDc | 208..336 | CDD:214729 | 42/144 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5190 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |