DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTDSP2 and Fcp1

DIOPT Version :9

Sequence 1:XP_005268613.1 Gene:CTDSP2 / 10106 HGNCID:17077 Length:277 Species:Homo sapiens
Sequence 2:NP_001286846.1 Gene:Fcp1 / 37925 FlyBaseID:FBgn0035026 Length:880 Species:Drosophila melanogaster


Alignment Length:212 Identity:50/212 - (23%)
Similarity:83/212 - (39%) Gaps:68/212 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    47 AQHVGQSSSSTELAAYK------------EEANTIAKSD----LLQCL----------------- 78
            |:..|:......:..||            :|...:.|.|    |.:|:                 
  Fly    99 AKDAGKPGGDCAIQRYKSQRAGVVKKRLRKEGELLTKGDAILELSECIHTTVIKDMCADCGADLR 163

Human    79 QYQFYQVRDSGLIPGTCLLPE--VTE--------EDQGR------ICVVIDLDETLVHSSFKPIN 127
            |.:..|..::. :|....:|:  ||:        :|..|      :.:::|||:|::|::    |
  Fly   164 QNENGQTSEAS-VPMVHTMPDLKVTQKLAQKLGHDDTRRLLADRKLVLLVDLDQTVIHTT----N 223

Human   128 NADFIVPIEIEGTTH-QVY--------VLKRPYVDEFLRRMGELFECVLFTASLAKYADPVTDLL 183
            :.   ||..|:|..| |:|        ...||...|||.||.:|:|..:.|.....||..:..||
  Fly   224 DT---VPDNIKGIYHFQLYGPHSPWYHTRLRPGTAEFLERMSQLYELHICTFGARNYAHMIAQLL 285

Human   184 DRCGVFRAR--LFRESC 198
            |..|.|.:.  |.|:.|
  Fly   286 DPEGKFFSHRILSRDEC 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTDSP2XP_005268613.1 HIF-SF_euk 107..266 CDD:274055 34/109 (31%)
Fcp1NP_001286846.1 Biotinyl_lipoyl_domains 59..142 CDD:299706 7/42 (17%)
FCP1_euk 202..348 CDD:131304 33/108 (31%)
COG5275 481..>658 CDD:227600
BRCT 587..665 CDD:278934
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.