DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTDSP2 and CG17597

DIOPT Version :9

Sequence 1:XP_005268613.1 Gene:CTDSP2 / 10106 HGNCID:17077 Length:277 Species:Homo sapiens
Sequence 2:NP_001286066.1 Gene:CG17597 / 35140 FlyBaseID:FBgn0032715 Length:407 Species:Drosophila melanogaster


Alignment Length:186 Identity:36/186 - (19%)
Similarity:55/186 - (29%) Gaps:85/186 - (45%)


- Green bases have known domain annotations that are detailed below.


Human    28 SPKKPRGRNIFKALFCC---------------FRAQHVGQSSSSTELAAYK---EEANTIAKSDL 74
            ||:...|  :...|.||               |..:| |....:.|:...:   :.|:|.|...|
  Fly   203 SPQVVEG--VLTKLQCCPTSDGSGAAILASEAFVRRH-GLEKQAVEIVGMEMASDPASTFADKSL 264

Human    75 LQCLQYQFYQVRDSGLIPGTCLLPEVTEEDQGRICVVIDLDETLVHSSFKPINNADFIVPIEIEG 139
            ::              |.||         |..|:..    :.....|.:||              
  Fly   265 MK--------------IAGT---------DMTRLAT----ERLFAKSGYKP-------------- 288

Human   140 TTHQVYVLKRPYVDEFLRRMGELFECVLFTAS-LAKYADPVTDLLDRCGVFRARLF 194
              ..|.|:             ||.:|  |:|: |..|     :.|..||..:|..|
  Fly   289 --QDVQVV-------------ELHDC--FSANELITY-----EALGLCGEGKAGEF 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTDSP2XP_005268613.1 HIF-SF_euk 107..266 CDD:274055 18/89 (20%)
CG17597NP_001286066.1 PRK08256 5..396 CDD:181327 36/186 (19%)
SCP-x_thiolase 9..395 CDD:238425 36/186 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2522
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.