DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTDSP2 and Dd

DIOPT Version :9

Sequence 1:XP_005268613.1 Gene:CTDSP2 / 10106 HGNCID:17077 Length:277 Species:Homo sapiens
Sequence 2:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster


Alignment Length:176 Identity:70/176 - (39%)
Similarity:101/176 - (57%) Gaps:9/176 - (5%)


- Green bases have known domain annotations that are detailed below.


Human   107 RICVVIDLDETLVHS--------SFKPINNADFIVPIEIEGTTHQVYVLKRPYVDEFLRRMGELF 163
            |..:|:||||||:||        :.||....||.|.:.|:....:.:|.|||:||.||..:.:.:
  Fly    60 RKTLVLDLDETLIHSHHNAMPRNTVKPGTPHDFTVKVTIDRNPVRFFVHKRPHVDYFLDVVSQWY 124

Human   164 ECVLFTASLAKYADPVTDLLDR-CGVFRARLFRESCVFHQGCYVKDLSRLGRDLRKTLILDNSPA 227
            :.|:||||:..|...|.|.||. ..:.|.|.:|:.|....|.|.||||.:..||.:..|:||||.
  Fly   125 DLVVFTASMEIYGAAVADKLDNGRNILRRRYYRQHCTPDYGSYTKDLSAICSDLNRIFIIDNSPG 189

Human   228 SYIFHPENAVPVQSWFDDMADTELLNLIPIFEELSGAEDVYTSLGQ 273
            :|...|.||:|::|||.|..||.||:|:|:.:.|....||.:.|.:
  Fly   190 AYRCFPNNAIPIKSWFSDPMDTALLSLLPMLDALRFTNDVRSVLSR 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTDSP2XP_005268613.1 HIF-SF_euk 107..266 CDD:274055 67/167 (40%)
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 67/167 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.