DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPIF and CG10907

DIOPT Version :10

Sequence 1:NP_005720.1 Gene:PPIF / 10105 HGNCID:9259 Length:207 Species:Homo sapiens
Sequence 2:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster


Alignment Length:192 Identity:61/192 - (31%)
Similarity:92/192 - (47%) Gaps:46/192 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    48 VYL-DVDANGKPL-----GRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQA 106
            :|: :...:||.|     |.:.:||.|...||...||..||.  :|: ||.:.|||::..|:.|.
  Fly     4 IYIQEPPTSGKVLLKTTVGDIDIELWARECPKACRNFVQLCL--EGY-YKNTEFHRLVKGFIVQG 65

Human   107 GDFTNHNGTGGKSIYGSRFPDE-NFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVV 170
            || .|.:||||:||||..|.|| :..|::...|::.|||:|.:.||||||.....|..|..|:.:
  Fly    66 GD-PNGDGTGGESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTL 129

Human   171 FGHV-----------KEGM------------------------DVVKKIESFGSKSGRTSKK 197
            ||.:           ::|:                        |:|.:|.|..|...:.:||
  Fly   130 FGKITGDTIYNMLKLEDGIVDHQERPMHAHRIVSTEVLSNPFDDIVPRILSQPSTKSKKTKK 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPIFNP_005720.1 cyclophilin_ABH_like 46..204 CDD:238907 61/192 (32%)
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 55/173 (32%)
PTZ00121 <279..>426 CDD:173412
CWC27_CTD 390..451 CDD:412084
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.