DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPIF and Cyp40

DIOPT Version :10

Sequence 1:NP_005720.1 Gene:PPIF / 10105 HGNCID:9259 Length:207 Species:Homo sapiens
Sequence 2:NP_648338.1 Gene:Cyp40 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster


Alignment Length:173 Identity:84/173 - (48%)
Similarity:113/173 - (65%) Gaps:8/173 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    43 SGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFG-------YKGSTFHRVIP 100
            |.|||||||:....:..||:::||:.|||||||||||||||||.|.|       |||:.||::..
  Fly    12 STNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKR 76

Human   101 SFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAG-PNTNGSQFFICTIKTDWL 164
            .|:.|:||...::|:.|:||||..|.||||.|.|...||:||||.| ||:|.|||||.....:.|
  Fly    77 VFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENL 141

Human   165 DGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS 207
            :|.:||.|.|..|:.:|.::|...:..|..:..|||.|||:::
  Fly   142 NGTNVVVGRVLRGLGIVAEMEQNCTDEGDPTAPIVIRDCGEIA 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPIFNP_005720.1 cyclophilin_ABH_like 46..204 CDD:238907 80/165 (48%)
Cyp40NP_648338.1 cyclophilin 15..181 CDD:469651 80/165 (48%)
TPR 231..>370 CDD:440225
TPR repeat 285..315 CDD:276809
TPR repeat 320..346 CDD:276809
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.