DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPIF and CG7747

DIOPT Version :10

Sequence 1:NP_005720.1 Gene:PPIF / 10105 HGNCID:9259 Length:207 Species:Homo sapiens
Sequence 2:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster


Alignment Length:141 Identity:65/141 - (46%)
Similarity:87/141 - (61%) Gaps:12/141 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    49 YLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHN 113
            |:.::.|   ||.:.|||..|..|:..:||...|.  .|: |....|||.|.:|:.|.||.|. :
  Fly   281 YVRLNTN---LGPLNLELFCDQTPRACDNFIKHCA--NGY-YNNVMFHRSIRNFIVQGGDPTG-S 338

Human   114 GTGGKSIYGSRFPDE---NFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVK 175
            |:||:||:|.:|.||   |.|  |.|.|||||||:|||||||||||.......|||||.:||.:.
  Fly   339 GSGGESIWGKKFEDEFKPNLT--HTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLV 401

Human   176 EGMDVVKKIES 186
            .|:|.::|:|:
  Fly   402 GGLDTLQKMEN 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPIFNP_005720.1 cyclophilin_ABH_like 46..204 CDD:238907 65/141 (46%)
CG7747NP_611113.1 RING-Ubox_PPIL2 41..113 CDD:438325
RING_Ubox 104..162 CDD:473075
cyclophilin_RING 281..439 CDD:238904 65/141 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.