DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TSPAN1 and Tsp39D

DIOPT Version :9

Sequence 1:XP_011538762.1 Gene:TSPAN1 / 10103 HGNCID:20657 Length:258 Species:Homo sapiens
Sequence 2:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster


Alignment Length:233 Identity:59/233 - (25%)
Similarity:95/233 - (40%) Gaps:34/233 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     7 IKTMMILFNLLIFLCGAALLAVGIWVSIDGASFLKIFGPLSSSAMQFVN-----VGYFLIAAGVV 66
            :|.:....|||..|.|..:..||..|.::.|.:           ..||:     ....|:..|..
  Fly     9 VKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHY-----------SNFVSDHVWTAPIILMIVGAA 62

Human    67 VFALGFLGCYGAKTESKCALVTFFFILLLIFIAEVAAAVVALVYTT-----MAEHFLTLLVVPAI 126
            |..:.||||.||..||.|.:::|..:.::||:.|:...:...|..|     |...|.:.:     
  Fly    63 VAVICFLGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTM----- 122

Human   127 KKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQK 191
             :.|..:.|:...|......|.|||.....|:| :.|  .||..|..||:....:.|.| ||...
  Fly   123 -QHYKERADYRDAWTLLQTELDCCGINGPNDWE-TVY--RNSTLPAACCSVINLSEAKE-CTNTH 182

Human   192 AHDQKVEGCFNQLLYDIRTNAVTVGGVAAGIGGLEFFS 229
            |..   .||..:||..:.:..:.:..|..|:.|::..:
  Fly   183 ATQ---HGCLQKLLEILDSKTLILASVVLGVAGIQMLT 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TSPAN1XP_011538762.1 Tetraspannin 7..214 CDD:278750 56/216 (26%)
uroplakin_I_like_LEL 110..212 CDD:239409 27/106 (25%)
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 59/233 (25%)
tetraspanin_LEL 104..200 CDD:239401 28/108 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.