DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TSPAN1 and Tsp5D

DIOPT Version :9

Sequence 1:XP_011538762.1 Gene:TSPAN1 / 10103 HGNCID:20657 Length:258 Species:Homo sapiens
Sequence 2:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster


Alignment Length:266 Identity:54/266 - (20%)
Similarity:104/266 - (39%) Gaps:68/266 - (25%)


- Green bases have known domain annotations that are detailed below.


Human     4 FSFIKTMMILFNLLIFLCGAALLAVGIWVSIDGASFLKIF---GPLSSSAMQFVNVGYFLIAAGV 65
            ::.|:......|::::||..|.|..|:|:.:..|.:..:.   ..||:..: |:.:|    ..| 
  Fly     6 YTCIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADTI-FMGIG----GTG- 64

Human    66 VVFALGFLGCYGAKTESKCALVTFFFILLLIFIAEVAAAVVALVY-----TTMAEHFLTLLVVPA 125
              |.:.|.||.||..:|:|.||.:|.:::::|::|.....:|.::     .|:|.....     .
  Fly    65 --FVVSFFGCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRF-----G 122

Human   126 IKKDYGSQE-------DFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTA 183
            |::.|.|.:       ....:|::..:..:|||.::|.|:.|...:......|..||        
  Fly   123 IERHYNSSDRGSLVAPSVASIWDSVQQSFECCGVSSYEDWYDIQSWPGRRWVPESCC-------- 179

Human   184 NETCTKQKAHDQKV--------------------------EGCFNQLLYDIRTNAVTVGGVAAGI 222
                  :..:||:.                          :||.:.|..........||.|..||
  Fly   180 ------RTLYDQRQVLTEGSGDGMMRPDCGRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGI 238

Human   223 GGLEFF 228
            ..::.|
  Fly   239 AFVQLF 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TSPAN1XP_011538762.1 Tetraspannin 7..214 CDD:278750 48/247 (19%)
uroplakin_I_like_LEL 110..212 CDD:239409 20/139 (14%)
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 54/264 (20%)
NET-5_like_LEL 105..228 CDD:239418 20/141 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X124
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.