DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TSPAN2 and Tsp42Er

DIOPT Version :9

Sequence 1:NP_005716.2 Gene:TSPAN2 / 10100 HGNCID:20659 Length:221 Species:Homo sapiens
Sequence 2:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster


Alignment Length:219 Identity:57/219 - (26%)
Similarity:99/219 - (45%) Gaps:35/219 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    11 IKYLLLGFNLLFWLAGSAVIAFGLWFRFGGAIKELSSEDKSPEYFYVGLYVLVGAGALMMAVGFF 75
            |:||...||.|..:.|.|.|...:.     ||.:::.:|:    ..:|||:.|  |:::..:.||
  Fly     8 IRYLAFLFNFLCAVLGIATIVVNVI-----AIDQIAPKDQ----LILGLYIAV--GSIVFLLSFF 61

Human    76 GCCGAMRESQCVLGSFFTCLLVIFAAEVTTGVFAFIGKGVAIRHVQTMYEEAYNDYLKDR-GKGN 139
            ||.||::||.||..::.|.:||:....:.. :|.|          :..:||.....||.. .|..
  Fly    62 GCFGAIKESICVTWAYATSMLVMLIVSIVM-LFVF----------RMHFEEDSITKLKQAFAKQT 115

Human   140 GT---LITFHSTFQCCG----KESSE---QVQPTC--PKELLGHKNCIDEIETIISVKLQLIGIV 192
            .|   :..:.:.:||||    |:..:   .|..:|  ..:......|:.::||.....|:...||
  Fly   116 NTFDAMAEYQTQYQCCGIYKLKDYGDAYITVPSSCYDQNDTPYRDGCLAKMETQYEELLKGPKIV 180

Human   193 GIGIAGLTIFGMIFSMVLCCAIRN 216
            |..:..:.|....||.::..::||
  Fly   181 GWMLMVIEIGAFTFSTIMGVSLRN 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TSPAN2NP_005716.2 Tetraspannin 11..210 CDD:395265 55/211 (26%)
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 53/208 (25%)
tetraspanin_LEL 93..174 CDD:239401 18/90 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.