DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NOTCH2NLB and slow

DIOPT Version :9

Sequence 1:XP_011508558.1 Gene:NOTCH2NLB / 100996763 HGNCID:53923 Length:412 Species:Homo sapiens
Sequence 2:NP_647898.3 Gene:slow / 38540 FlyBaseID:FBgn0035539 Length:512 Species:Drosophila melanogaster


Alignment Length:379 Identity:90/379 - (23%)
Similarity:126/379 - (33%) Gaps:101/379 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    63 PRKFQPNFGRLRRRPRSG---GLRARG-VEAFAPGLRSVAPGPEPLKQEEGRREWGSSIGTPSPC 123
            |....|.:|:.....:..   |:|.|| ..:|.|.:......|..|.:........|||||..|.
  Fly   135 PMPLSPRYGKGEDNTQDVEFIGVRERGRGYSFVPSVTVTTAPPPNLNRRSASPGSRSSIGTIPPL 199

Human   124 GSAQAAAAEEATEKMPALRPALLWALLALWLCCATPAHALQCRDGYEPCVNEGMCVTYHNGTGYC 188
            ..|:...:...|...|                   |.:.:...:.:|         |...|.|| 
  Fly   200 VPARRGYSYTTTTSSP-------------------PVNTITTDNPFE---------TNTIGRGY- 235

Human   189 KCPEGFLGEYCQHRDPCEKNR---CQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSR 250
                        ..||.|..|   |....|........:...|.........||    .|.|..:
  Fly   236 ------------PTDPKEMERRHICMQQRTVTMPVKRTEVYSRPTWKHVATPCQ----PPTFSGQ 284

Human   251 PCLNGGTCH-MLSRD----------TYECTCQVGFTG--KECQWTDACL----SHPCANGSTCTT 298
            .|......| ...||          ||:| |    ||  :|...:|:|:    |..|.||..||.
  Fly   285 KCTRVQVVHEQAYRDVIDHKTAQQMTYDC-C----TGWSRENPRSDSCMKPICSARCQNGGNCTA 344

Human   299 VANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGICLNLPGSYQCQCLQGFTGQYCDSLYVPCA 363
            .:   :|.|.|||||:.||.||:||.....|...  |:|..|||.|:|.|||..|          
  Fly   345 PS---TCSCPTGFTGRFCEQDVDECQTEKPCDQQ--CINTHGSYFCRCRQGFVLQ---------- 394

Human   364 PSPCVNGGTCRQ---TGDFTFECNCLPETV-----RRGTELWERDREVWNGKEH 409
                .:..:|::   ..|..||...|...:     ...|.|.:.::.:.|.:.|
  Fly   395 ----SDQQSCKKVSTNADDAFEARDLENDIDDTDAEVATRLQKIEKSLANERVH 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NOTCH2NLBXP_011508558.1 EGF_CA 246..280 CDD:238011 12/46 (26%)
EGF_CA 283..317 CDD:238011 15/37 (41%)
EGF_CA 319..355 CDD:238011 16/35 (46%)
slowNP_647898.3 EMI 246..318 CDD:284877 17/80 (21%)
EGF_CA <336..360 CDD:238011 12/26 (46%)
EGF_CA 362..401 CDD:214542 16/54 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.