DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NOTCH2NLB and dsl-4

DIOPT Version :9

Sequence 1:XP_011508558.1 Gene:NOTCH2NLB / 100996763 HGNCID:53923 Length:412 Species:Homo sapiens
Sequence 2:NP_001359594.1 Gene:dsl-4 / 184563 WormBaseID:WBGene00001106 Length:368 Species:Caenorhabditis elegans


Alignment Length:214 Identity:70/214 - (32%)
Similarity:97/214 - (45%) Gaps:36/214 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   186 GYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSR 250
            || ||..|:.|..|...| |..| |.|.|:|   .:.||  |.|:.||.|..|:|     |..|.
 Worm   154 GY-KCAPGYSGPNCDKVD-CPFN-CHNHGSC---EVPGK--CMCSQGFFGTYCEY-----CKPST 205

Human   251 PCLNGGT------CHMLSRDTYECTCQVGFTGKECQWTDAC-LSHPCANGSTCT--TVANQFSCK 306
            .|.:|..      ||     .|.|.|..|:.|......|.| .:.||.:|:..:  ||:..|.|.
 Worm   206 TCKHGAVLVNELGCH-----PYTCRCFEGYAGDNGDKDDVCYYAKPCRHGNCVSNVTVSGGFECI 265

Human   307 CLTGFTGQKCETDVN--ECDIPGHCQHGGICLNLPGSYQCQCLQGFTGQYCD-SLYVPCAPSPCV 368
            |...|.|::||..:.  :|...|:||:.|:|..:.|..:|:|..||||::|: .....|....|.
 Worm   266 CPKAFGGRRCEKRIARWDCSDEGYCQNKGVCSFVDGISRCRCAVGFTGKHCERKTAKTCLKKKCR 330

Human   369 NGGTC----RQTGDFTFEC 383
            .|..|    ::||  |..|
 Worm   331 EGFICIIDNKKTG--TMPC 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NOTCH2NLBXP_011508558.1 EGF_CA 246..280 CDD:238011 11/39 (28%)
EGF_CA 283..317 CDD:238011 12/36 (33%)
EGF_CA 319..355 CDD:238011 13/37 (35%)
dsl-4NP_001359594.1 DSL 110..166 CDD:366627 6/12 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I4042
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.