DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NOTCH2NLC and rexd-1

DIOPT Version :10

Sequence 1:NP_001350942.1 Gene:NOTCH2NLC / 100996717 HGNCID:53924 Length:293 Species:Homo sapiens
Sequence 2:NP_497463.3 Gene:rexd-1 / 175329 WormBaseID:WBGene00021440 Length:681 Species:Caenorhabditis elegans


Alignment Length:154 Identity:35/154 - (22%)
Similarity:45/154 - (29%) Gaps:56/154 - (36%)


- Green bases have known domain annotations that are detailed below.


Human    67 GYCKCPEGFLGEYCQHRDPC-------EKNRCQNGGTCV-----------AQAMLG--------- 104
            ||.......|.|..:|||.|       |.:.....|:.:           ..||.|         
 Worm   224 GYVMSDRIVLAEDPRHRDVCFHRIVLRESDGFPEPGSFIRFDAEKIDFLNIYAMKGIVNLNDQRA 288

Human   105 ---------KATCRC---ASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTG 157
                     |.|.|.   :.||     .||.:..||:..|  |....|.|.......|.|||.:.
 Worm   289 LPRTANGNIKTTIRLHNDSPGF-----YYSEALQCFMDDP--NNVLEHWLLSKYSNSTLQVGISA 346

Human   158 KECQWTDACLSHPCANGSTCTTVA 181
            .|          |.|.|:....:|
 Worm   347 GE----------PSAIGTPRFVIA 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NOTCH2NLCNP_001350942.1 EGF_CA 200..236 CDD:238011
rexd-1NP_497463.3 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.