DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARPC5 and Arpc5

DIOPT Version :10

Sequence 1:NP_001257368.1 Gene:ARPC5 / 10092 HGNCID:708 Length:154 Species:Homo sapiens
Sequence 2:NP_608693.1 Gene:Arpc5 / 33444 FlyBaseID:FBgn0031437 Length:151 Species:Drosophila melanogaster


Alignment Length:150 Identity:77/150 - (51%)
Similarity:107/150 - (71%) Gaps:5/150 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNP 65
            |:|||.|:| |||:|||:|:|:.|.:::......|||||.|:.:.|..   |....||.:||:|.
  Fly     1 MAKNTSSNA-FRKIDVDQYNEDNFREDDGVESAAAGPDESEITTLLTQ---GKSVEALLSALQNA 61

Human    66 PINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNG-VDLLMKYIYKGFESPSDNSSAMLL 129
            |:..|:|.|||.|.:|.|:||:|.|:..:::|:.:||:|. :|:||||||:|||.||:.||..||
  Fly    62 PLRCKNQNVKDHALNITLRVLLSIKSTQMDQAIDTLDQNDLIDVLMKYIYRGFEIPSEGSSGHLL 126

Human   130 QWHEKALAAGGVGSIVRVLT 149
            ||||||.|.||||.|||||:
  Fly   127 QWHEKAFAKGGVGCIVRVLS 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARPC5NP_001257368.1 P16-Arc 10..152 CDD:461399 71/140 (51%)
Arpc5NP_608693.1 P16-Arc 9..147 CDD:461399 72/141 (51%)

Return to query results.
Submit another query.