| Sequence 1: | NP_005702.3 | Gene: | EDIL3 / 10085 | HGNCID: | 3173 | Length: | 480 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001287558.1 | Gene: | Ser / 43275 | FlyBaseID: | FBgn0004197 | Length: | 1407 | Species: | Drosophila melanogaster |
| Alignment Length: | 203 | Identity: | 67/203 - (33%) |
|---|---|---|---|
| Similarity: | 81/203 - (39%) | Gaps: | 62/203 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Human 26 CDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPT--------SAGPCTP-- 80
Human 81 -----------------------------NPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHC 116
Human 117 QHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHR 181
Human 182 ALFGLQKW 189 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| EDIL3 | NP_005702.3 | EGF_CA | 27..59 | CDD:238011 | 19/31 (61%) |
| EGF_CA | 79..117 | CDD:238011 | 15/68 (22%) | ||
| Cell attachment site (Potential) | 96..98 | 0/1 (0%) | |||
| EGF_CA | 119..155 | CDD:238011 | 15/35 (43%) | ||
| FA58C | 157..314 | CDD:214572 | 9/33 (27%) | ||
| FA58C | 160..313 | CDD:238014 | 8/30 (27%) | ||
| FA58C | 318..476 | CDD:214572 | |||
| FA58C | 321..475 | CDD:238014 | |||
| Ser | NP_001287558.1 | MNNL | 83..161 | CDD:284966 | |
| DSL | 220..282 | CDD:279722 | |||
| EGF_CA | 350..388 | CDD:238011 | |||
| EGF_CA | 490..526 | CDD:238011 | |||
| EGF_CA | 610..645 | CDD:238011 | |||
| EGF_CA | 647..683 | CDD:238011 | |||
| EGF_CA | 798..833 | CDD:238011 | 20/32 (63%) | ||
| EGF_CA | 879..913 | CDD:238011 | 14/40 (35%) | ||
| EGF_CA | 916..952 | CDD:238011 | 15/35 (43%) | ||
| VWC_out | <993..1053 | CDD:214565 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 50 | 1.000 | Domainoid score | I11681 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.910 | |||||