DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment USH1C and CG15803

DIOPT Version :9

Sequence 1:XP_016872564.1 Gene:USH1C / 10083 HGNCID:12597 Length:956 Species:Homo sapiens
Sequence 2:NP_001287388.1 Gene:CG15803 / 42206 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster


Alignment Length:397 Identity:70/397 - (17%)
Similarity:113/397 - (28%) Gaps:209/397 - (52%)


- Green bases have known domain annotations that are detailed below.


Human    87 EVRLDRLHPE--GLGLSVRGGLEFGC------GLFISHLIKGGQADSVG-LQVGDEIVRINGYSI 142
            |..:..||..  |||::|.|   :.|      |:|:..:|:|..|::.| :|:.|.||.::|.|:
  Fly   307 ETYVVELHKNVYGLGITVAG---YVCEEEDLSGIFVKSIIEGSAAETSGQIQINDRIVAVDGRSL 368

Human   143 SSCTHEEVINLIRTKKTV----------SIKVRH--IGLIPVK---------------------- 173
            |..|:.:.:.|:|....|          ..|..|  :.|..:|                      
  Fly   369 SGVTNHQAVELLRNTDIVVHLTLERFLRGRKYEHLQVALTEIKGTSAPSGLDRSQDKDQDQESQL 433

Human   174 SSPDEP----LTW---------------------QYV------DQFV------------------ 189
            |.|..|    |:|                     :||      |:|:                  
  Fly   434 SMPGSPSIATLSWLPPKSLDADSIATEGDEAVDAEYVGISGAEDEFIELPSRDTVESNMSHVLDR 498

Human   190 -SESGGVR--------------------------------------------------------- 196
             ..|||:.                                                         
  Fly   499 SDHSGGLTKDQVPRISPIVPLTNGRSLILADDSGNDTDEQCAEPETETAQARKGSKPETERVKDL 563

Human   197 ---------------GSLGSPGNRENKE-------------KKVFISLVGSRGLGCSI------- 226
                           |.:.:|.|....:             |.:.|||.|:..:.|.|       
  Fly   564 GDTKTDTDPDPDLDPGQMPTPTNEAPVKAASPTAASLRVAWKSLGISLEGTVDVECGIEKRPHHY 628

Human   227 -----SSGPIQKPGIFISHVKPGSLSAEVGLEIGDQIVEVNGVDFSNLDHKEAVNVLKSSRSLTI 286
                 :.||:.:.||               |..||::::||......|.|.|.|.:||...: .:
  Fly   629 IRSILADGPVGRQGI---------------LRPGDELLQVNEHKLQGLRHIEVVKILKELPA-RV 677

Human   287 SIVAAAG 293
            .:|.|.|
  Fly   678 KLVCARG 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
USH1CXP_016872564.1 None
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492
PDZ 307..393 CDD:214570 26/88 (30%)
PDZ_signaling 605..680 CDD:238492 22/90 (24%)
PDZ 773..858 CDD:214570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.