| Sequence 1: | NP_005692.1 | Gene: | SNUPN / 10073 | HGNCID: | 14245 | Length: | 360 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_728769.2 | Gene: | CG42304 / 38332 | FlyBaseID: | FBgn0259200 | Length: | 565 | Species: | Drosophila melanogaster |
| Alignment Length: | 64 | Identity: | 16/64 - (25%) |
|---|---|---|---|
| Similarity: | 29/64 - (45%) | Gaps: | 16/64 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Human 291 PAGPLTTKPDYAGHQ-LQQIMEHKKSQKEGMKEKLTHKASENGHYELEHLS--TPKLKGSSHSP 351 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| SNUPN | NP_005692.1 | Necessary for interaction with XPO1. /evidence=ECO:0000269|PubMed:10209022 | 1..159 | ||
| Necessary for interaction with KPNB1 and m3G-cap U1 and U5 snRNP import receptor activity. /evidence=ECO:0000269|PubMed:18187419, ECO:0000269|PubMed:9670026 | 1..65 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..42 | ||||
| Snurportin1 | 25..64 | CDD:402920 | |||
| Snurportin-1_C | 97..280 | CDD:185717 | |||
| Interaction with m3G-cap structure. /evidence=ECO:0000269|PubMed:15920472, ECO:0007744|PDB:1XK5 | 127..129 | ||||
| Necessary for binding to the m3G-cap structure. /evidence=ECO:0000269|PubMed:9670026 | 208..328 | 10/37 (27%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 339..360 | 5/15 (33%) | |||
| CG42304 | NP_728769.2 | DNTTIP1_dimer | 137..206 | CDD:408020 | |
| Blue background indicates that the domain is not in the aligned region. | |||||