DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNUPN and CG42304

DIOPT Version :10

Sequence 1:NP_005692.1 Gene:SNUPN / 10073 HGNCID:14245 Length:360 Species:Homo sapiens
Sequence 2:NP_728769.2 Gene:CG42304 / 38332 FlyBaseID:FBgn0259200 Length:565 Species:Drosophila melanogaster


Alignment Length:64 Identity:16/64 - (25%)
Similarity:29/64 - (45%) Gaps:16/64 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   291 PAGPLTTKPDYAGHQ-LQQIMEHKKSQKEGMKEKLTHKASENGHYELEHLS--TPKLKGSSHSP 351
            ||..|.::||....| |||..:.:::|.:..::.             :|.|  ||.:.|:..:|
  Fly   268 PAALLLSQPDLQPVQPLQQQQQQEQTQTQNQQQP-------------QHRSTVTPLVGGTLPTP 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNUPNNP_005692.1 Necessary for interaction with XPO1. /evidence=ECO:0000269|PubMed:10209022 1..159
Necessary for interaction with KPNB1 and m3G-cap U1 and U5 snRNP import receptor activity. /evidence=ECO:0000269|PubMed:18187419, ECO:0000269|PubMed:9670026 1..65
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
Snurportin1 25..64 CDD:402920
Snurportin-1_C 97..280 CDD:185717
Interaction with m3G-cap structure. /evidence=ECO:0000269|PubMed:15920472, ECO:0007744|PDB:1XK5 127..129
Necessary for binding to the m3G-cap structure. /evidence=ECO:0000269|PubMed:9670026 208..328 10/37 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 339..360 5/15 (33%)
CG42304NP_728769.2 DNTTIP1_dimer 137..206 CDD:408020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.