DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDH9 and CadN2

DIOPT Version :9

Sequence 1:NP_057363.3 Gene:CDH9 / 1007 HGNCID:1768 Length:789 Species:Homo sapiens
Sequence 2:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster


Alignment Length:854 Identity:217/854 - (25%)
Similarity:350/854 - (40%) Gaps:248/854 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    40 LTKDDGKMLRRTKRGWMWNQFFLLEEYTGTDTQYVGKLHTDQDKGDGNLKYILTGDG------AG 98
            :|::|.:.|  .||         :.:.|.||        .|.|: ..|:.|.|||.|      |.
  Fly   145 ITEEDDRNL--PKR---------ILQVTATD--------GDVDR-PINIVYFLTGQGIDPDNPAN 189

Human    99 SLFVIDENTGDIHAAKKLDREEKSLYILRAKAIDRKTGRQVEPESEFI----------------- 146
            |.|.|:..||||...|.|||             |:..||   |:..|.                 
  Fly   190 SKFDINRTTGDIFVLKPLDR-------------DQPNGR---PQWRFTVFAQDEGGEGLVGYADI 238

Human   147 -IKIHDINDNEPKFTKDLYTASVPEMSGVGTSVIQVTATDADDANYGNSAKVVYSILQ------- 203
             :.:.|||||.|:|.:.:|..:|.|....|:||:.::|.|.||.|...:||::|||.:       
  Fly   239 QVNLKDINDNAPQFPQGIYFGNVTENGTAGSSVMTMSAVDYDDPNESTNAKLIYSIEKNVIEEET 303

Human   204 GQPYFSVDPESGIIKTALPDMSRENREQYQVVIQAKDMGGQMGGLSGTTTVNITLTDVNNNPPRF 268
            |.|.|.::||:|:||||:..:.||....|.:.:.|.|    .|||.||.|.:|.:.|:|:.||:|
  Fly   304 GAPIFEIEPETGLIKTAVCCLDRERTPDYSIQVVAMD----GGGLKGTGTASIRVKDLNDMPPQF 364

Human   269 PQSTYQFNSPESVPLGTHLGR-----IKANDPDVGENAEMEYSIA--EGDGADMFDVITDKDTQE 326
            .:..:.....|:  .||::..     :...|.|  |....:|.:.  .|.|||.|.::.:.| ..
  Fly   365 TKDEWVTEVDET--NGTYIPETPILTVTVQDED--ETNTFQYKVVPNSGFGADKFAMVRNGD-GT 424

Human   327 GIITVKQNLDFENQML---YTLRVDASNTHPDPRFLHLGPFKDT------AVVKISVEDI-DEPP 381
            |.:.:.|.||:|:.:.   :..|:..::...|      ||....      :.|.:.:.|| |..|
  Fly   425 GSLKIIQPLDYEDPLQSSGFRFRIQVNDKGDD------GPGGSDKYHVAYSWVVVKLRDINDNVP 483

Human   382 VFTKVSYLIEVDEDVKEGSIIGQVTAYDPD-ARNNLIKYSVDRHTDMDRIFGIHSENGSIFTLKA 445
            .|.:....:.:.||.|.|:|:.|..|.|.| ..::.:.|.:.|.|:..|.|.| |:.|::...:.
  Fly   484 KFDREHIEVSIYEDTKVGTILEQFKATDADQGGHSKVAYKIVRSTNRKRQFAI-SDRGAVSIQRP 547

Human   446 LDRESSPWHNITVTATEINNPKQSSHIPVFIRILDINDHAPEFAMYYETFVCENAKPGQLIQTVS 510
            ||||:...|:|.:.|.:..:|.:::...:.:.:.|:||:||.||..|:..:.||.. |:.|..|:
  Fly   548 LDRETQDRHHIQILAIDDGSPARTATATLTVIVKDVNDNAPTFAQDYKPTLPENVS-GKKILEVA 611

Human   511 VMDKDDPPRGH----KFFFEPVPEFTLNPNFTIV-----DNKDNTAGIMTRKDGYSRNKMSTYLL 566
            ..|.||..||:    .|..:|:....:...|.:.     || :|...|::....:.|....:|.:
  Fly   612 AKDPDDRLRGNGGPFTFRLDPLASDEIKAGFKVEYDRRGDN-ENGVAIISSLRPFDREAQKSYAI 675

Human   567 PILIFDNDYPIQSSTGTLTIRVCACDNQGNMQSCTAEALILSAGLSTGALVAILLCVLILLILVV 631
            ||.|.||..|..:.|.|||:.:                                           
  Fly   676 PIEIKDNGAPAMTGTSTLTVTI------------------------------------------- 697

Human   632 LFAALKRQRKKEPLIISKDDVRDN--------IVTYNDEGGGEEDTQAFDIGT--LRNPEAREDS 686
                              .||.||        ::.||.:|    .:|...||.  :.:|:..:  
  Fly   698 ------------------GDVNDNKMQPGSKSVLVYNYQG----QSQDTPIGRVYVNDPDDWD-- 738

Human   687 KLRRDVMPETIFQIRRTVPLWENIDVQDFIHRRLK-END-------ADPSAPPYDSLATYAYE-- 741
                  :|:..:       .||   ||:  |:|.| :.|       |......| .|....|:  
  Fly   739 ------VPDKKY-------YWE---VQE--HQRFKLDTDTGILTMRAGTRRGRY-QLRFKVYDRE 784

Human   742 -GNDSIADSLS-SLESLTADCNQ-----------DYDYLSDWGP-----------RFK-KLAD-M 780
             |.:.|..:|| ::..:||:..|           |.|::..|.|           ||: |||: :
  Fly   785 HGQEDIPANLSVTVRDITAEAVQQAGSMRLSHITDEDFVRTWNPVKNQVEPSKLERFRNKLAELL 849

Human   781 YGGDDSDRD 789
            |    :|||
  Fly   850 Y----TDRD 854

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDH9NP_057363.3 Cadherin_repeat 72..155 CDD:206637 28/106 (26%)
Cadherin_repeat 164..264 CDD:206637 40/106 (38%)
Cadherin_repeat 272..379 CDD:206637 25/123 (20%)
Cadherin_repeat 387..484 CDD:206637 27/97 (28%)
Cadherin_repeat 492..589 CDD:206637 30/105 (29%)
Cadherin_C 645..782 CDD:279398 40/182 (22%)
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637
Cadherin_repeat 140..248 CDD:206637 36/138 (26%)
Cadherin_repeat 256..359 CDD:206637 39/106 (37%)
Cadherin_repeat 379..481 CDD:206637 23/110 (21%)
Cadherin_repeat 489..586 CDD:206637 27/97 (28%)
Cadherin_repeat 594..703 CDD:206637 32/171 (19%)
Cadherin_repeat 724..801 CDD:206637 20/97 (21%)
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5199
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24027
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.