DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NR1H3 and Hr96

DIOPT Version :9

Sequence 1:XP_024304052.1 Gene:NR1H3 / 10062 HGNCID:7966 Length:511 Species:Homo sapiens
Sequence 2:NP_524493.1 Gene:Hr96 / 42993 FlyBaseID:FBgn0015240 Length:723 Species:Drosophila melanogaster


Alignment Length:548 Identity:112/548 - (20%)
Similarity:190/548 - (34%) Gaps:181/548 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    98 CSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAHYICHSGGHCPMDTYMRRKCQECRLRKCRQAG 162
            |:||||||.|:::|.::||.||.||||:.:....:.|....:|.:....||.||:||||||...|
  Fly     7 CAVCGDKALGYNFNAVTCESCKAFFRRNALAKKQFTCPFNQNCDITVVTRRFCQKCRLRKCLDIG 71

Human   163 MREECVLSEEQIRLKKLKRQE--------------------EEQAH------------------- 188
            |:.|.::|||...:|:.|.:.                    ||:.|                   
  Fly    72 MKSENIMSEEDKLIKRRKIETNRAKRRLMENGTDACDADGGEERDHKAPADSSSSNLDHYSGSQD 136

Human   189 ---------------------------------------ATSLPPRASSPPQILPQLSPEQLGMI 214
                                                   ..|.|.|||.....|.:...|.:.::
  Fly   137 SQSCGSADSGANGCSGRQASSPGTQVNPLQMTAEKIVDQIVSDPDRASQAINRLMRTQKEAISVM 201

Human   215 EKLVAAQQQCNRRSF------SDRLRVTPWPMAPDPHSREARQQRFAHFTELAIVSVQEIVDFAK 273
            ||::::|:...|...      .|.|::.. .....|.:......:|.......:..:.:|||...
  Fly   202 EKVISSQKDALRLVSHLIDYPGDALKIIS-KFMNSPFNALTVFTKFMSSPTDGVEIISKIVDSPA 265

Human   274 QLPGFLQ---LSREDQIALLK------TSAIEV------AGEGQGMKGEAEWDYLWEGPPDIELG 323
            .:..|:|   .|.||.|.::.      ..|:.:      .|.....:..|:...|.:..|.::..
  Fly   266 DVVEFMQNLMHSPEDAIDIMNKFMNTPAEALRILNRILSGGGANAAQQTADRKPLLDKEPAVKPA 330

Human   324 EP---------NLLGSRDEENRPP-----------------WKRPCSKTSPPSPRLRFAACVQV- 361
            .|         ::||     |.||                 .::|.:.:|.|.|.:..:....: 
  Fly   331 APAERADTVIQSMLG-----NSPPISPHDAAVDLQYHSPGVGEQPSTSSSHPLPYIANSPDFDLK 390

Human   362 MLLETSRRYNPGSESITFLKDFSYNR-EDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIA 425
            ..::|:....|..:|     |||.|. |......:::|:        :|.|.:|.          
  Fly   391 TFMQTNYNDEPSLDS-----DFSINSIESVLSEVIRIEY--------QAFNSIQQ---------- 432

Human   426 ISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPH-------------DRLMFPRMLMKLVS 477
                :|.|  |::::.. ..|.|| ...::..:...||             ||.:.....|||..
  Fly   433 ----AASR--VKEEMSY-GTQSTY-GGCNSAANNSQPHLQQPICAPSTQQLDRELNEAEQMKLRE 489

Human   478 LRTLSSV----HSEQVFALRLQDKKLPP 501
            ||..|..    ..|.:.||.:.|.::.|
  Fly   490 LRLASEALYDPVDEDLSALMMGDDRIKP 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NR1H3XP_024304052.1 NR_DBD_LXR 78..178 CDD:143534 35/79 (44%)
NR_LBD_LXR 210..509 CDD:132752 65/358 (18%)
Hr96NP_524493.1 NR_DBD_CAR 5..98 CDD:143524 37/90 (41%)
NR_LBD 462..>573 CDD:299703 14/56 (25%)
NR_LBD_F1 523..702 CDD:132727
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157558
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4152
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24082
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.990

Return to query results.
Submit another query.