DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LOC100536511 and APE3

DIOPT Version :9

Sequence 1:XP_021329973.1 Gene:LOC100536511 / 100536511 -ID:- Length:400 Species:Danio rerio
Sequence 2:NP_009845.2 Gene:APE3 / 852589 SGDID:S000000490 Length:537 Species:Saccharomyces cerevisiae


Alignment Length:153 Identity:38/153 - (24%)
Similarity:64/153 - (41%) Gaps:24/153 - (15%)


- Green bases have known domain annotations that are detailed below.


Zfish    44 DVGLSYFDRESNETV---ISMCECGK-------FGINSPLRSASG-LAVLPNSDPLACSKNTTFT 97
            ||.|..|:..|.:.:   :|..|.||       |.::.|:....| |..:||   |.|.:....:
Yeast   133 DVSLQEFEALSGKIISFNLSDAETGKSFANTTAFALSPPVDGFVGKLVEIPN---LGCEEKDYAS 194

Zfish    98 A----SHQPWIALIKTGKCSYTKKINAAQREGASAVVIYNEDGTGNDVILMMYSGADDLVAINIG 158
            .    .::..||||:.|||.:..|.|.|.:.|.:|||||:.:....:.:..............:|
Yeast   195 VVPPRHNEKQIALIERGKCPFGDKSNLAGKFGFTAVVIYDNEPKSKEGLHGTLGEPTKHTVATVG 259

Zfish   159 NILGTQIAYLINNGLDVNMTINV 181
                  :.|.:...|..|:.:|:
Yeast   260 ------VPYKVGKKLIANIALNI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LOC100536511XP_021329973.1 PA_GRAIL_like 47..179 CDD:239037 35/146 (24%)
zf-rbx1 <188..303 CDD:331150
RING_Ubox 262..308 CDD:327409
APE3NP_009845.2 M28_SGAP_like 78..506 CDD:349873 38/153 (25%)
PA_ScAPY_like 155..284 CDD:239045 32/131 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000832
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.