DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LOC100536511 and gol

DIOPT Version :9

Sequence 1:XP_021329973.1 Gene:LOC100536511 / 100536511 -ID:- Length:400 Species:Danio rerio
Sequence 2:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster


Alignment Length:283 Identity:74/283 - (26%)
Similarity:140/283 - (49%) Gaps:32/283 - (11%)


- Green bases have known domain annotations that are detailed below.


Zfish    85 SDPLACSKNTTFTA------SHQPWIALIKTGKCSYTKKINAAQREGASAVVIYNEDGTGNDVIL 143
            ||..||:.....|.      ..:.||||::.|:|::.:|:....::.|:.|:|||:........:
  Fly   117 SDDYACTPYIRGTLGAPIPDKGETWIALVRRGRCTFEEKVKHVYQQNAAGVIIYNDKQVMQLEKM 181

Zfish   144 MMYSGADDLVAINIGNILGTQIAYLINNGLDVNMTI-----NVATPTGVWKGTWAYVLSFTFIGI 203
            .:.....::.|:.....:|..::..::.|.:|.::|     .|.|.:.:.:.:..:| |.:||.:
  Fly   182 QIKGKTRNIAAVITYQNIGQDLSLTLDKGYNVTISI
IEGRRGVRTISSLNRTSVLFV-SISFIVL 245

Zfish   204 TAVTMFYFAFLFMKRMYINRQLRRQQMEIKRETEKAIGKLEVRTLRTNDPEVDSDDTGCVVCTDS 268
            ..:::.:..|.:::|....:...:|...:...|:|||.|:..:|.:.:| |.|.|...|.:|.::
  Fly   246 MIISLVWLIFYYIQRFRYMQAKDQQSRNLCSVTKKAIMKIPTKTGKFSD-EKDLDSDCCAICIEA 309

Zfish   269 YQRGEQVTVLPCRHLYHKKCIEPWLLEHPTCPMCKYNILK-------SSIEEDSYDQPSPSSSSS 326
            |:..:.:.:|||:|.:||.||:|||:||.||||||.::||       .|.|.....||.|...  
  Fly   310 YKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDVLKFYGYVFLGSEESILEYQPDPPQG-- 372

Zfish   327 SSSSSNDTFCLATITSADQRSTL 349
                      ||.:.:.|:.:.|
  Fly   373 ----------LALVEARDESADL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LOC100536511XP_021329973.1 PA_GRAIL_like 47..179 CDD:239037 21/99 (21%)
zf-rbx1 <188..303 CDD:331150 37/114 (32%)
RING_Ubox 262..308 CDD:327409 22/45 (49%)
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 21/99 (21%)
UPF0233 226..>258 CDD:299753 6/32 (19%)
zf-RING_2 301..344 CDD:290367 20/42 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 1 1.000 - - FOG0000832
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22765
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.