DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LOC100536511 and SPAP32A8.03c

DIOPT Version :9

Sequence 1:XP_021329973.1 Gene:LOC100536511 / 100536511 -ID:- Length:400 Species:Danio rerio
Sequence 2:NP_594179.1 Gene:SPAP32A8.03c / 2542072 PomBaseID:SPAP32A8.03c Length:513 Species:Schizosaccharomyces pombe


Alignment Length:137 Identity:41/137 - (29%)
Similarity:76/137 - (55%) Gaps:16/137 - (11%)


- Green bases have known domain annotations that are detailed below.


Zfish   237 EKAIGKLEVRTLRTNDPEVDSDDTG-CVVCTDSYQRGEQVTVLPCRHLYHKKCIEPWLLEHPTCP 300
            |..|.|::|:    ..|:...|:.| |.:|.:.::..:.|..|||:|.:|:.||:|||..:.||.
pombe   374 EDVIAKMKVQ----KPPKELIDEEGECTICMEMFKINDDVIQLPCKHYFHENCIKPWLRVNGTCA 434

Zfish   301 MCKYNI-----LKSSIEEDSYDQPSPSS-SSSSSSSSNDTFCLATITSADQRSTLQSNIQTEETA 359
            :|:..:     .:::...||.:..:||: ::.|:|::||..  ||:.:....:..|||:.:|.  
pombe   435 ICRAPVDPNSQQRNNTSTDSANGHNPSNHANPSTSTTNDQG--ATLRNESFNAASQSNLSSEH-- 495

Zfish   360 GGHTSDT 366
             ||:|.|
pombe   496 -GHSSRT 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LOC100536511XP_021329973.1 PA_GRAIL_like 47..179 CDD:239037
zf-rbx1 <188..303 CDD:331150 22/66 (33%)
RING_Ubox 262..308 CDD:327409 16/50 (32%)
SPAP32A8.03cNP_594179.1 HypA <1..34 CDD:302785
zf-RING_2 394..437 CDD:290367 16/42 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.