DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LOC100536511 and H10E21.5

DIOPT Version :9

Sequence 1:XP_021329973.1 Gene:LOC100536511 / 100536511 -ID:- Length:400 Species:Danio rerio
Sequence 2:NP_497129.1 Gene:H10E21.5 / 175169 WormBaseID:WBGene00019185 Length:473 Species:Caenorhabditis elegans


Alignment Length:195 Identity:57/195 - (29%)
Similarity:94/195 - (48%) Gaps:17/195 - (8%)


- Green bases have known domain annotations that are detailed below.


Zfish   196 LSFTFIGITAVTMFYFAFLFMKRMYINRQLRRQQMEIKRETEKAIGKLEVRTLRTN-DPEVDSDD 259
            :|.:||.:..:::.:..|.:::|........|.|..:.....||:.::...|:... ..|:.|| 
 Worm   163 VSISFIILMVISLAWLVFYYVQRFRYAHAKDRLQRRLFNAARKALTRIPTMTITPGMTQELQSD- 226

Zfish   260 TGCVVCTDSYQRGEQVTVLPCRHLYHKKCIEPWLLEHPTCPMCKYNILK-----SSIEEDSYDQP 319
              |.||.|.||..:.:.:|||:|:|||.||:||||||.||||||.:|||     :.|..| ...|
 Worm   227 --CAVCLDPYQLQDVIRLLPCKHIYHKSCIDPWLLEHRTCPMCKNDILKHFGYWNDIRND-IQMP 288

Zfish   320 SPSSSSSSSSSSNDTFCLATITSADQRSTLQSNIQTEETAGGHTSDTVNCNLDIHTQHIYDNPGF 384
                  ::|....|.|.:.......:.....:::.:.| |...|||:...:.|....|..::.|:
 Worm   289 ------TNSRGIADDFTIRLELGEQEHQAPSADVISPE-ANSDTSDSQGFSFDNSEHHHSESFGY 346

Zfish   385  384
             Worm   347  346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LOC100536511XP_021329973.1 PA_GRAIL_like 47..179 CDD:239037
zf-rbx1 <188..303 CDD:331150 38/107 (36%)
RING_Ubox 262..308 CDD:327409 28/45 (62%)
H10E21.5NP_497129.1 HRD1 <150..325 CDD:227568 51/172 (30%)
RING-H2_GRAIL 226..273 CDD:319582 29/49 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000832
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22765
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.