DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EPPIN-WFDC6 and tfpi2

DIOPT Version :9

Sequence 1:NP_001185915.1 Gene:EPPIN-WFDC6 / 100526773 HGNCID:38825 Length:179 Species:Homo sapiens
Sequence 2:NP_001035185.1 Gene:tfpi2 / 560339 ZFINID:ZDB-GENE-060503-38 Length:233 Species:Danio rerio


Alignment Length:192 Identity:57/192 - (29%)
Similarity:80/192 - (41%) Gaps:43/192 - (22%)


- Green bases have known domain annotations that are detailed below.


Human     6 LLSLLVLFVLLANVQGPGLTDWLFPRRCPKIREECEFQ-ERDVCTKD----------RQC----- 54
            ||..|:||:.:.. ...|||  |.|      :|.|..| |...|..|          :||     
Zfish     5 LLGALLLFISVLE-SAVGLT--LQP------KEVCLLQIEEGTCNDDIQRFYYNTISQQCEEFSY 60

Human    55 ------QDNKKCCVFSCGKKCLDLKQ--DVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQ 111
                  |:|.:..| .|.|.|..:.:  .:|...|:.|||...|..::::.....|..|.|||||
Zfish    61 SGCGGNQNNFRSFV-ECQKTCFRIPKIPQICRFQKKEGPCRGLFSRYFFNMTSMQCEPFTYGGCQ 124

Human   112 GNNNNFQSKANCLNTCKNKQPCPKIKVECEVEEIDQCTKPRDCPENMKCCPF-SRGKKCLDF 172
            ||.|||::...|:..||   |...|.|.|    :|...|.| |..::....: |..|.|.:|
Zfish   125 GNENNFRNPEECIEYCK---PPKTIPVIC----LDNLDKGR-CSASIPRYYYNSATKTCEEF 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EPPIN-WFDC6NP_001185915.1 WAP 32..71 CDD:278522 14/60 (23%)
Kunitz_BPTI 76..128 CDD:278443 19/51 (37%)
tfpi2NP_001035185.1 KU 28..80 CDD:197529 13/52 (25%)
Kunitz_BPTI 89..141 CDD:278443 19/51 (37%)
Kunitz_BPTI 149..201 CDD:278443 9/35 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.