DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EPPIN-WFDC6 and C54D10.10

DIOPT Version :9

Sequence 1:NP_001185915.1 Gene:EPPIN-WFDC6 / 100526773 HGNCID:38825 Length:179 Species:Homo sapiens
Sequence 2:NP_506123.2 Gene:C54D10.10 / 183787 WormBaseID:WBGene00008304 Length:216 Species:Caenorhabditis elegans


Alignment Length:174 Identity:41/174 - (23%)
Similarity:60/174 - (34%) Gaps:70/174 - (40%)


- Green bases have known domain annotations that are detailed below.


Human    60 CCVFSCGKKCLDLKQDVCEMPKETG------PCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQ 118
            ||:.|       :....|...|:||      |..   |.:::|.:.|.|....|.||.||.|.|:
 Worm    11 CCISS-------VSAINCRQEKDTGVNCDNKPIT---LKFYFDMRTNVCQPLFYRGCGGNENRFE 65

Human   119 SKANCLNTC------KNKQPCPK----------IKVECEVEE----------IDQCTKPRD---- 153
            |:..|.:.|      |.|:|..|          .:.:.|.||          ::.|..|.|    
 Worm    66 SRDACSDACVPHKPGKTKKPEKKEDDGEAETDDDEEDSEEEEVQVNKDMSLIVNACKLPTDAKIV 130

Human   154 ---------CPENMK------CCPF---------SRGKKCLDFR 173
                     ||...:      |||:         |.|.:.|.|:
 Worm   131 TKAQKCDNGCPTGYRCTKKNFCCPYPDHVCSLPVSSGSERLAFK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EPPIN-WFDC6NP_001185915.1 WAP 32..71 CDD:278522 3/10 (30%)
Kunitz_BPTI 76..128 CDD:278443 19/63 (30%)
C54D10.10NP_506123.2 Kunitz_BPTI 21..75 CDD:278443 18/56 (32%)
KU 158..214 CDD:238057 4/17 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161450432
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X627
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.