DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCDC169-SOHLH2 and twist2

DIOPT Version :9

Sequence 1:NP_001185839.1 Gene:CCDC169-SOHLH2 / 100526761 HGNCID:38866 Length:502 Species:Homo sapiens
Sequence 2:NP_001005956.1 Gene:twist2 / 30395 ZFINID:ZDB-GENE-980526-235 Length:163 Species:Danio rerio


Alignment Length:85 Identity:14/85 - (16%)
Similarity:36/85 - (42%) Gaps:7/85 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   268 ASLSEFEKNKKISLLHSSKEKLRRERIKYCCEQLRTLLPYVKGRKNDAASVLEATVDYVKYIREK 332
            :|...||:.:...:|.:.:|:.|.:.:......||.::|.:...|......|:....|:.::.:.
Zfish    59 SSTQSFEELQNQRVLANVRERQRTQSLNEAFASLRKIIPTLPSDKLSKIQTLKLASRYIDFLCQV 123

Human   333 ISPAVMAQITEALQSNMRFC 352
            :.       ::.:.:.|..|
Zfish   124 LQ-------SDEMDNKMSSC 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCDC169-SOHLH2NP_001185839.1 DUF4600 <6..81 CDD:292016
HLH 283..334 CDD:238036 8/50 (16%)
twist2NP_001005956.1 HLH 70..120 CDD:278439 9/49 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.