DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment RBM14-RBM4 and SPAC222.18

DIOPT Version :9

Sequence 1:	NP_001185774.1	Gene:	RBM14-RBM4 / 100526737	HGNCID:	38840	Length:	339	Species:	Homo sapiens
Sequence 2:	NP_001343068.1	Gene:	SPAC222.18 / 9407033	PomBaseID:	SPAC222.18	Length:	111	Species:	Schizosaccharomyces pombe

Alignment Length:	54	Identity:	12/54 - (22%)
Similarity:	21/54 - (38%)	Gaps:	15/54 - (27%)

- Green bases have known domain annotations that are detailed below.

Human    57 GHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDV 110
            |...:||..|               ::.|......::.|...||:.||::.||:
pombe    11 GFNYKPGHTL---------------YIRNFGTDMRARTLGQAFEKWGRIVRCDI 49

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
RBM14-RBM4	NP_001185774.1	RRM1_CoAA	1..71	CDD:241052	4/13 (31%)
		RRM_SF	79..>113	CDD:302621	8/32 (25%)
		ZnF_C2HC	136..151	CDD:197667
SPAC222.18	NP_001343068.1	RRM_SF	19..94	CDD:327398	9/46 (20%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23147
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100