DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM14-RBM4 and rsd1

DIOPT Version :9

Sequence 1:NP_001185774.1 Gene:RBM14-RBM4 / 100526737 HGNCID:38840 Length:339 Species:Homo sapiens
Sequence 2:NP_594422.2 Gene:rsd1 / 2542545 PomBaseID:SPAC19G12.07c Length:603 Species:Schizosaccharomyces pombe


Alignment Length:219 Identity:48/219 - (21%)
Similarity:80/219 - (36%) Gaps:64/219 - (29%)


- Green bases have known domain annotations that are detailed below.


Human     2 KIFVGNVDGADTTPEELAALFAPYGTVMSCAVM-------KQFAFVHMRENAGALRAIEALHGHE 59
            ::.|.|:. .:.|.|::.|:|.|:|.:....:.       |.|.::..|....|..|:|.::|.:
pombe   341 RLCVSNIH-FNLTDEDVKAIFEPFGDIEFVHLQRDDQNRSKGFGYIQYRNPISARNALEKMNGFD 404

Human    60 LRPGRALVV--------------------------EMSRPRPLNTWKIFVGNVSAACTSQELR-- 96
            | .||.:.|                          |.|:|...|       ..|:...||:.|  
pombe   405 L-AGRNMRVCLGNDKFTTETTSSMLKRFDETLARQERSQPSQRN-------GGSSTYESQDYREA 461

Human    97 ---SLFERRGRVIECDVVKGK--RMHVQLSTSRLRTAPGMGDQSGC------YRCGKE--GHWSK 148
               |..|...|.|..|.:..|  |.......|:|.:.|....:|.|      :...:|  .:|.:
pombe   462 APLSPTEEESRPITRDELMKKLARSEDISDNSKLVSEPEPPIRSRCALLENMFNPAEETSPNWVQ 526

Human   149 ECPIDRSGRVADLTEQYNEQYGAV 172
            |..       .|:.|:.:|:||.|
pombe   527 ELE-------QDVKEECDEKYGKV 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM14-RBM4NP_001185774.1 RRM1_CoAA 1..71 CDD:241052 20/101 (20%)
RRM_SF 79..>113 CDD:302621 9/38 (24%)
ZnF_C2HC 136..151 CDD:197667 4/22 (18%)
rsd1NP_594422.2 RRM1_RBM39_like 241..313 CDD:240729
RRM2_RBM23_RBM39 342..413 CDD:240730 18/72 (25%)
RBM39linker 476..523 CDD:292157 9/46 (20%)
RRM3_RBM39_like 505..589 CDD:240731 11/46 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.