powered by:
Protein Alignment RBM14-RBM4 and SPAC23A1.09
DIOPT Version :9
Sequence 1: | NP_001185774.1 |
Gene: | RBM14-RBM4 / 100526737 |
HGNCID: | 38840 |
Length: | 339 |
Species: | Homo sapiens |
Sequence 2: | NP_594439.1 |
Gene: | SPAC23A1.09 / 2541998 |
PomBaseID: | SPAC23A1.09 |
Length: | 121 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 77 |
Identity: | 18/77 - (23%) |
Similarity: | 32/77 - (41%) |
Gaps: | 13/77 - (16%) |
- Green bases have known domain annotations that are detailed below.
Human 12 DTTPEELAALFAPYGTVMS--------CAVMKQFAFVHMRENAGALRAIE----ALHGHELRPGR 64
:.|.|::..|||.:|.|.: ...:|.:|.:.......|.:|:: :|...:|....
pombe 20 EATEEQVEDLFADFGPVKNLHLNLDRRTGYVKGYALIEYATLEQAQKAVDEKNLSLLDEKLEVDF 84
Human 65 ALVVEMSR-PRP 75
|.:....| |||
pombe 85 AFLEPPERAPRP 96
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.